KEGG   Bombus terrestris (buff-tailed bumblebee): 100650566Help
Entry
100650566         CDS       T04364                                 

Definition
(RefSeq) protein henna isoform X1
  KO
K00500  phenylalanine-4-hydroxylase [EC:1.14.16.1]
Organism
bter  Bombus terrestris (buff-tailed bumblebee)
Pathway
bter00360  Phenylalanine metabolism
bter00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bter00790  Folate biosynthesis
bter01100  Metabolic pathways
bter01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bter00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    100650566
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    100650566
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    100650566
Enzymes [BR:bter01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.16  With reduced pteridine as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.16.1  phenylalanine 4-monooxygenase
     100650566
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Biopterin_H ACT
Motif
Other DBs
NCBI-GeneID: 100650566
NCBI-ProteinID: XP_003397986
AA seq 494 aa AA seqDB search
MISTARYIAHFKVDGNEWPSVHLFHTVDRDMYAKVVAKSQPMSQNDTSNSSTLDKPTLIH
GGNYIKEGKDSARSTCLIFSPKEEDSVGALSKYLKLFAEHKVNLSHIESRSSLRRTNMYE
FMVECVPGGDLGTVIEKLREQCSYFSIISRNHKDNMGTVPWFPRRIRDLDKFANQILSYG
AELDSDHPGFTDPVYRQRRKYFADLAFNYKYGQSIPRVEYTKEEIETWGVVFRNLTKLYP
KYACKEHNHVFPLLIENCGYREDNIPQLEDISNFLKDCTGFTLRPVAGLLSSRDFLAGLA
FRVFHCTQYIRHGSKPLYTPEPDICHEVLGHVPLFADPSFAQFCQVVGLASLGSPDEYIE
KLATCFWFTVEYGLCQQNGELKAYGAGLLSSFGELEYCLSDKPELRPFEPAKTALQKYPI
TEYQPVYYVAENFEDAKQKMIKFTESIPRKFGVRYDPYTQSISIIDSKHQIEDLVHNVNQ
EVQILMDALRKLRQ
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgatatctactgcgcgatatatcgcgcattttaaagtcgatggaaacgaatggccgagt
gttcatctttttcataccgtcgatcgtgatatgtacgcgaaagttgtagcgaaatctcaa
cctatgtctcaaaacgacacgtccaattcttcaacccttgacaagcctacgctgatacat
gggggaaactacatcaaagaaggtaaggactcggcaaggagcacctgcctgattttttca
cccaaagaagaggactccgtcggagcgttgagcaaatatcttaaacttttcgctgaacat
aaggttaatctgtcgcatatagaatccagaagctctcttcgtcgaacgaatatgtacgag
tttatggtggaatgcgtgcctggcggagaccttggaacagtgattgaaaaactacgggaa
caatgcagctacttctcgatcatttctagaaatcacaaagataacatgggaactgtacca
tggtttccaagaagaatcagagatctggacaagtttgccaatcaaattctctcgtatgga
gcagaattggacagcgatcatcctggattcacggatcctgtttatcgacaaaggcgcaaa
tactttgcagatttggcgttcaattacaaatatggtcaatcgataccaagggtggagtat
accaaagaagaaatcgaaacatggggtgtagttttcagaaacttaacgaagctttatcca
aagtatgcctgcaaggaacataatcacgtgtttcccttgttaatcgagaattgtggctac
agagaggacaatattccgcaattggaggacatatcaaactttttaaaagattgcaccggt
ttcactcttcgacctgtggctggccttctatcttcgcgcgacttcctagctggtctggct
ttcagagtatttcactgcacacagtacattaggcacggtagtaaaccattgtacacgcct
gaacctgatatttgtcacgaagtactgggtcacgttcccttgttcgctgatccgtcattc
gcacaattttgccaagtcgttggcttggcgtctctcggatctcctgacgaatacatcgaa
aaattagctacgtgcttctggtttacggttgagtacggtctgtgccaacaaaatggcgaa
ctaaaggcatacggtgctggattgctgtcatctttcggcgaactcgagtattgtttgagc
gacaaaccagaattgcgtcctttcgaaccagcaaagacagcgttgcaaaagtatccgata
accgagtaccaacctgtctattacgttgccgagaatttcgaggacgccaaacagaaaatg
attaaattcacagagagtataccgaggaagtttggagtgagatacgacccgtatacccag
agcattagcataatcgacagtaaacatcaaatcgaggatctcgtgcacaacgtgaatcaa
gaagtacaaattttgatggacgctttaagaaaattgaggcaatag

DBGET integrated database retrieval system