KEGG   Bombus terrestris (buff-tailed bumblebee): 100650821Help
Entry
100650821         CDS       T04364                                 

Definition
(RefSeq) probable pterin-4-alpha-carbinolamine dehydratase
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
bter  Bombus terrestris (buff-tailed bumblebee)
Pathway
bter00790  Folate biosynthesis
bter01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bter00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    100650821
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bter04147]
    100650821
Enzymes [BR:bter01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     100650821
Exosome [BR:bter04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100650821
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pterin_4a Dna2
Motif
Other DBs
NCBI-GeneID: 100650821
NCBI-ProteinID: XP_012170199
AA seq 139 aa AA seqDB search
MSTLTRMRFMNGGGMLRGKIFHIFDQRSISAPALKKNKMGKLTQEEREKDLKPLLSNGWS
VQQNRDAIYKEFLFKNFNQAFGFMTKVALQAEKMDHHPEWFNVYNKVNITLSSHDVNGLS
QRDVKLASFIDKAAKVGEN
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
atgtcgactttaacgcgcatgcgatttatgaatggtgggggaatgctacgaggaaagata
ttccatattttcgatcaaagaagtatatctgctcctgctttaaaaaagaacaaaatggga
aaacttactcaagaagaacgagaaaaggatttaaaaccattgttatctaatggttggtct
gtgcaacaaaatagagatgctatttataaggaatttttattcaaaaactttaatcaagca
tttggttttatgacaaaagttgcattacaagcagaaaaaatggatcatcaccctgaatgg
ttcaatgtttacaacaaagtaaacatcactttgtcttctcatgatgtgaatggtttatca
cagagggatgtaaaactcgcatctttcatagacaaggctgctaaagtgggagaaaactaa

DBGET integrated database retrieval system