KEGG   Bombus terrestris (buff-tailed bumblebee): 100651072Help
Entry
100651072         CDS       T04364                                 

Definition
(RefSeq) plancitoxin-1 isoform X1
  KO
K01158  deoxyribonuclease II [EC:3.1.22.1]
Organism
bter  Bombus terrestris (buff-tailed bumblebee)
Pathway
bter04142  Lysosome
Brite
KEGG Orthology (KO) [BR:bter00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    100651072
Enzymes [BR:bter01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.22  Endodeoxyribonucleases producing 3'-phosphomonoesters
    3.1.22.1  deoxyribonuclease II
     100651072
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNase_II
Motif
Other DBs
NCBI-GeneID: 100651072
NCBI-ProteinID: XP_020724105
AA seq 383 aa AA seqDB search
MKQKIENMKVIFYATTLIIASNVICGARYNKLQCKDEKDVPVDWYVLYKLPKVHTSSNPL
IREGIAYLYITNATIETGWQVSSRPIGSNNSIPGITLAPLYNQDNKNESIWSLYNDSPPN
SSYAWSFGHTKGVVMANSDQGFWLIHSVPNFPPVPKSGVQTRRLKRENITADGKYSYPVS
GTFYGQSFLCISLGSDQFDIIGEQLIYNEIAVYAKNIPDILGKQYPVLKNAINQKHIKTP
PYNHKAVIRSLRMIEFISFAKDGKWGKDLYGDFVAPQLQTDLYVQSWLNGRGKLPSICTR
RKIYNVKSFEFDVANVNFASSQDHSKWAITDTKKSANRWVCIGDINRADTQYSRGGGIVC
FKEARLWTDYRNIINDVEPCNHT
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaaaagatcgagaacatgaaagttatattttacgcaactacgttaataatcgcg
agtaacgttatatgtggcgcccgatacaataaattacaatgtaaagatgaaaaagatgta
ccggtggattggtacgtgctttataagttaccaaaagttcatacaagtagtaatcccctg
attagagaaggaattgcttatctgtacataacgaatgcaactattgaaactggttggcaa
gtgtcttctaggcccatcggttcgaataattccatccctggaattacattagcgccgctt
tacaatcaggataacaagaatgaaagcatatggagtttatataacgatagtccaccaaat
tcttcttatgcctggagctttggtcacacaaagggtgtagtgatggcaaatagtgaccaa
ggcttctggttaattcacagcgttccaaatttccctccagttcctaaaagtggtgtgcaa
actcgacggttaaaaagggaaaatattactgccgatgggaaatacagttatccggtaagt
ggaacgttttacggacaaagttttttatgtatttcccttggcagtgatcagttcgatatt
attggagaacaattaatctacaacgaaatagcagtgtacgcgaaaaatattcctgatata
cttggtaaacagtacccagtattgaaaaatgcgatcaatcagaaacatatcaaaactcct
ccctacaaccataaagctgtaataagatctctaagaatgattgaattcatttcgtttgct
aaggatggaaaatggggtaaagatttatacggagattttgtagcgccacaattgcagaca
gatttatatgttcagtcatggttgaatggtcgaggcaagttaccctcaatttgtacccgt
agaaaaatctacaatgttaaaagcttcgaattcgacgtagcgaatgtgaattttgccagt
agtcaggaccattcaaaatgggctattacagacaccaaaaagtccgctaatcgctgggtt
tgcatcggtgatatcaatagagccgatacacagtattctcgaggtggtggaatcgtatgt
ttcaaagaggctcgtttgtggactgattatcgtaatattataaatgacgtagagccttgt
aatcatacgtaa

DBGET integrated database retrieval system