KEGG   Bombus terrestris (buff-tailed bumblebee): 100651600Help
Entry
100651600         CDS       T04364                                 

Definition
(RefSeq) probable maleylacetoacetate isomerase 2
  KO
K01800  maleylacetoacetate isomerase [EC:5.2.1.2]
Organism
bter  Bombus terrestris (buff-tailed bumblebee)
Pathway
bter00350  Tyrosine metabolism
bter01100  Metabolic pathways
Module
bter_M00044  Tyrosine degradation, tyrosine => homogentisate
Brite
KEGG Orthology (KO) [BR:bter00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    100651600
Enzymes [BR:bter01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.2  maleylacetoacetate isomerase
     100651600
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_3 GST_C_2 GST_C Tom37
Motif
Other DBs
NCBI-GeneID: 100651600
NCBI-ProteinID: XP_003395565
AA seq 217 aa AA seqDB search
MSVMGKAILYSYWRSSCSWRVRIALNLKEIPYDIKPVSLIKSGGEQHSNEFREINPMEQV
PALHIDNHTLIESLNILQYLEETRPHRPLMPADPVKRARVREICEVIASGIQPLQNLVVL
IYVGEERKKEWAQHWITRGLTAVEKLLSSSAGKYCVGDEITLADCCLIPQIFNARRFLVD
LRPFPTILRVDRHLENHPAFTAAHPNNQPDCPPEATK
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgtccgtcatgggaaaggcaatactctactcctattggcggagttcttgttcgtggaga
gtacgaattgcactgaacttaaaagaaatcccctatgacataaaaccagttagcttgata
aaaagtggtggagaacaacattctaatgaattccgtgagatcaatccaatggagcaggtg
cctgcacttcatattgacaatcacacgttaatagaatctttaaatattttgcaataccta
gaagaaaccagaccacatcgacctttgatgcctgcagatccagtaaaacgagcaagagtc
agagaaatttgcgaggttattgctagtggtatacagcccttgcaaaatttagtcgtgttg
atttatgttggagaagaacgtaagaaggaatgggcacaacactggattactagaggttta
acagctgtagaaaaattattgtcatccagtgcagggaagtactgcgtaggtgatgaaatc
acgttagcagactgttgcttaataccacagatatttaatgcaaggaggtttctcgttgac
ttacgacctttcccaacgattttaagggtagatcgtcatttagagaatcacccagccttt
accgctgctcatccaaacaatcagcctgattgcccaccagaggcaaccaagtag

DBGET integrated database retrieval system