KEGG   Bombus terrestris (buff-tailed bumblebee): 105665949Help
Entry
105665949         CDS       T04364                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: titin
  KO
K12567  titin [EC:2.7.11.1]
Organism
bter  Bombus terrestris (buff-tailed bumblebee)
Brite
KEGG Orthology (KO) [BR:bter00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bter01001]
    105665949
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bter04131]
    105665949
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:bter04812]
    105665949
   04147 Exosome [BR:bter04147]
    105665949
Enzymes [BR:bter01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     105665949
Protein kinases [BR:bter01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   105665949
Membrane trafficking [BR:bter04131]
 Others
  Actin-binding proteins
   Others
    105665949
Cytoskeleton proteins [BR:bter04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     105665949
Exosome [BR:bter04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   105665949
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: I-set fn3 Ig_3 Ig_2 ig Y_Y_Y
Motif
Other DBs
NCBI-GeneID: 105665949
NCBI-ProteinID: XP_012166068
AA seq 1444 aa AA seqDB search
MGNATTKSHYSKSQPVSAIRRPRWEGSGLPAPPGKPILIPGADESQPDVVAIRWERSPSN
GGSAIVGYLVEHRRLGSQHWVRSTPGLCTFPELTLSGLEPGWRYQFRVRAQNAVGLSRPS
EISDPLTVTLQRSASSAPHFDLEVKDTTVLENEQAEFVVRFTGSPLPKIAWFKDGFEIFS
SRRTRIITDSGRSVLLIHQTALNDEGEIKCTATNRAGHASTKARLILEAPPKIRLPRQYE
DGLLFEQDETIRLKVSLAGRPPASVIWYHDGEVVSSDERHIFETMDGESILKIPDAKRID
RGEYTVKAINKLGEDTSSFLVTVTDRPARPGKATVTMTLGRSVTLSWTEPEDDGGCKIGT
YIVEYYRVGWDVWLKAITSRQTKATLSELIEGSEYKFRVKAENPYGVSEPSEESDVIFIP
DIKRGIMAPSLSGKSQSHREIRSREKREVSFAVPTQRTRSLTRDETRNRDEDDDVHFGPA
SRSVSAQRLTGRPSRADSRVKFALDTVDNSEPPPVPPARSKDHSISKVEGQVGNHVVRSS
VAMDLPSSENLIQDKEPSSVPITVATVTVTPPEVEESNKRLAYRESRSRSVSMSRERSMS
PLSKIQEQHEEEFSLSYSPLRSSLSLNFKNQEAIVDEPQIVKSHSLDDKATSPTTPREDD
DTVIHGSSEFMLVLYPQDQDKKLDDIAGRRKSLETPQITGNIIEDIEDLIPPPMSLSLPE
LFSVEHQVVETLREAVSSTELLHERAMERFYRAVAAEEASEVAKRKVQVERTTGELAATM
ETKSATETETDIFKRRLSNPTVTSPILMNWQSKKNRRRLSEGLPEKLKPLKILIPNLLPD
VEAMSDPNIISDSENPIVTSWGLDKPENTTIPLRRWHDANIPLVEEKPPEESIPWQPSAN
GDTTRNEMFPDTSQIDNLSPISKQNSQIEEKTKEEEIEDEEEESIETSEESSEEVSTADS
EDLKLLKTRILGRLVVEEEDTYHPRGRPVPHVEPEPPSIPPHRIPILDITPPTPPKTVAP
ISPTTVVPKSILKKPKEEPIPLNSFGRPIPPEKPIRKSLPPNVQAVNRNEEEQVKAPITS
EPLKVPVMSESDTDSVLSAGEAAKNRRIQAKARTTTSEEEVDEEDIEARMAMVNHYTEIV
REHSNRFNYRSSEERRLGDSIASSRRSSFSEDQDLNQIKDRAVISMISEKLNGRQGVKEI
QQVQQTKETKKSEVDRQEKSQVKRAAGSRGTTPARDTKPLKEKRTSRPSSRSQSPISRSR
NVSVERGVSSRSSSKTRVRAPSQDRRPPSRTGSEEQRFVRERSVDEGPRRSRKPSSKASS
RSSSRDRNRAETPVELKMERLQRALESKKYRSSRRGSSAKREYPEKAWRESRLNEEQLAI
EAKHNVRSTVGYITDLTLLLAAVYVYLFKKETMAIPFIALLLYRRVAEEIRGRVVEGWWF
KRKQ
NT seq 4335 nt NT seq  +upstreamnt  +downstreamnt
atgggcaacgccaccacgaagagccactactccaaaagtcagccagtctctgccattagg
agaccacgttgggagggatcagggcttccggcgccaccaggaaagccaattttgatacca
ggggcagacgaatcgcagccggatgtggttgctattcgttgggagaggtcaccaagtaac
ggtggctcggccattgtcggctatttggtcgaacatcgaaggctcggctcgcagcattgg
gtacgcagcacaccagggctttgcacctttccggaactgaccttgagcggcctcgaacca
ggatggcgctaccaattcagggtcagggctcagaacgcggttggtttgtctcgacccagc
gagatctcggatccgttgactgtgaccttgcagagatccgcttcatccgcgccccacttt
gaccttgaagtcaaggacaccaccgtgctcgaaaatgagcaggctgagttcgtggtgcga
tttacggggtctccgctgccaaaaatcgcatggttcaaagatggcttcgagattttcagt
agcaggcgaacgaggatcatcacggacagtggcaggagcgttctcctgattcatcaaacc
gcgctcaacgacgagggagaaataaaatgcaccgccactaacagagctggtcacgctagc
accaaagcgagactgattctagaagcaccaccaaagatacgacttccgcgtcaatacgaa
gatggacttcttttcgaacaagatgaaacaattagattaaaagtgtcattagctggaaga
cctccagcatcggtgatttggtaccacgacggtgaagtggtttcaagcgacgaaagacac
atttttgaaacgatggacggtgaatcgatcctgaagatccctgatgctaaacgaattgac
agaggagaatatactgttaaggcgataaataagcttggagaggatacgtcgtcgttttta
gtaactgtaacagatcgacccgcaagacctggaaaagcgacagtaacgatgaccttgggg
agatcggttacgctgtcgtggacagaaccggaagacgacggtggttgcaaaattggcaca
tacattgtcgagtactatagggtcggttgggacgtgtggttaaaggcaatcacgagtagg
cagaccaaagcaacgttgtccgagttaatcgaaggatctgagtataaatttcgagtgaaa
gcggagaatccgtatggtgtgagcgagcccagcgaggagagcgacgtaatcttcattcca
gatataaaaagaggcataatggcgccctcgttgagcggaaagtcgcagagtcatagagaa
attagatcgcgagagaaacgagaagtcagtttcgcagtgcctactcaaagaacgagaagc
ttgacaagagacgagactcgaaatcgggacgaagatgatgacgtacattttggaccagct
agtagatcagtatcagctcagagactcacaggtcgaccatccagagccgatagtagggtg
aaatttgccttggacacggtagacaattcggaaccaccacctgttcctccggccagatcg
aaggatcattccatttcaaaggttgaaggccaggttggaaatcacgtggttcgttcgagt
gttgctatggatctaccaagcagtgagaacttgattcaggataaggagccttcgtcagtg
ccaataactgttgccaccgtaacagtaacaccgccagaggtagaagaatctaataaacgg
ttagcgtacagagaatcacgatctcgatcagtttcgatgtccagagaacgtagtatgtca
ccgttgtctaaaattcaagaacaacacgaagaagaattttctttaagttactcacctctt
cgttcatcgttgagtttaaatttcaagaatcaagaggcgatcgtcgacgagccacaaatc
gttaaaagtcactcgttagatgataaagcaacatcacctaccactcctagggaggatgat
gatactgttatacatggaagttcagagtttatgctagttttataccctcaagatcaagat
aagaaactggacgatatcgctggaagacgaaagagtttagaaacgcctcaaatcacaggg
aacatcatagaggacatcgaagacctgataccgccacccatgtctctctccctcccagaa
ctgttcagcgtggaacaccaagtagtcgaaaccctccgcgaagcagtgagctccacagaa
cttcttcacgaacgtgccatggaacgtttctatcgtgcagtggcagccgaagaagcttcc
gaagtagccaaaagaaaagtgcaagtggaacgtacaaccggagagctggctgcaacaatg
gaaactaaatcagccaccgagacggaaactgacatctttaaacgacgactatccaatcct
actgtcacttcgccaattctaatgaattggcagtcaaagaaaaatcgtagaaggctaagc
gaaggcctaccagaaaaattaaaaccattaaaaatactaattcctaatttattgccagac
gtcgaagcaatgtctgatcccaatataattagcgattcagagaatccaattgtcacttca
tgggggctggacaagccagaaaacacgaccataccattgcgcaggtggcacgacgccaac
ataccattggtcgaagagaaaccaccagaagaatcgataccctggcagcccagcgccaat
ggagatactacgcgcaacgagatgttcccagacacctcacaaatagataatttgtctccg
atatcgaaacaaaactcacaaatagaagaaaagacaaaagaagaggaaatagaagatgag
gaagaagagagtatcgaaacatctgaagaatcatcggaagaggtcagcactgctgacagt
gaagacttgaagcttctgaagaccagaattcttggcaggctggtagtggaagaagaagac
acgtatcatccaagaggaaggcctgttccacacgtggaaccggaaccaccatcgattcct
cctcacaggatacctattttagatatcacaccaccaacgcctcctaaaacagttgctcct
atatcaccaactactgttgttcccaaatctatactgaagaagcctaaagaagagccaatt
ccactgaacagctttggtagaccgattcctcctgagaaaccaattaggaaatcacttcct
ccgaatgttcaagctgtgaataggaatgaagaagaacaagtaaaggcaccaatcacatcc
gagcctcttaaggtacctgtcatgtccgaatctgacactgacagtgtattatcagctggc
gaagctgcgaagaatcgcagaatccaggcaaaggcaaggaccactacatcggaagaagag
gtcgatgaggaggatatcgaggcacgaatggcgatggttaatcactataccgagatcgtc
agggaacactctaatcggtttaattatagaagctcggaggagaggaggcttggagatagt
atagctagctctagaagatcttcgttttccgaggaccaagatttaaatcagataaaggat
cgtgctgtaataagcatgatctctgagaaactaaatggaaggcagggcgttaaagaaatt
caacaggttcaacagacgaaagagacgaagaaaagtgaagttgatagacaggagaaatcg
caggttaaaagagctgctggttctcgaggaacgactccagctagggacacgaagccttta
aaggagaaacgaacgagtagaccaagttcaaggagccagtcacctatatcgaggtcacga
aacgtgtccgtagaaagaggagtttcttcaaggtcctcctccaagaccagagtcagagct
ccgtcacaagatagaagacctccttcgagaactggctcggaggaacaacgatttgtccga
gagagatctgtcgatgaaggtcctcgtcgatcgaggaaaccttcgtcgaaggcatcttca
aggtctagttctagagacaggaatagagccgaaacaccggtggaattgaagatggaacgt
ttacagagagctcttgagagtaaaaagtataggtcttccagacgtgggtccagtgcaaag
agagagtatcctgagaaagcttggcgtgagagtcggctgaacgaggaacaattggcaata
gaggccaagcataacgttaggtcaacggtaggatatataactgacctaactttattattg
gcggctgtttatgtttatttgtttaagaaggagactatggctattcctttcatcgcgttg
ttgctctatagaagagttgcggaagagattaggggaagagtggtggaaggatggtggttc
aaacgaaagcaataa

DBGET integrated database retrieval system