KEGG   Bacillus thuringiensis serovar finitimus YBT-020: YBT020_00210Help
Entry
YBT020_00210      CDS       T01839                                 

Gene name
ipk
Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
btf  Bacillus thuringiensis serovar finitimus YBT-020
Pathway
btf00900  Terpenoid backbone biosynthesis
btf01100  Metabolic pathways
btf01110  Biosynthesis of secondary metabolites
btf01130  Biosynthesis of antibiotics
Module
btf_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:btf00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    YBT020_00210 (ipk)
Enzymes [BR:btf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     YBT020_00210 (ipk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: ADY19295
UniProt: F0PPZ1
Position
48122..48991
Genome map
AA seq 289 aa AA seqDB search
MKLLVKAPAKINLSLDVLGKRQDGYHEVKMIMTTIDLADRLELMELAEDRIEILSHNRYV
PDDQRNLAYQAAKLLKEKFNVKKGVSITIEKTIPVAAGLAGGSSDAAATLRGLNKLWNLG
LTIDQLAELGAEIGSDVSFCVYGGTAIATGRGEQIEHIKTPPSCWVILAKPHIGVSTADV
YGNLKLNRVTHPDVDKMVDVINAGDYKGICDNVGNVLEDVTFAMHPEVARIKAQMKRFGA
DAVLMSGSGPTVFGLVHHDSRMHRIYNGLKGFCEQVYAVRLLGERETLE
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
ttgaagctactagtgaaagcaccagcaaagattaatctgtcgttagatgtactgggaaaa
agacaagacggatatcatgaagtgaaaatgattatgacaacaattgatttagcggatcgt
ttagaactaatggaattagcagaagaccgtattgaaattttatcccataatcggtatgtc
ccagacgaccaaagaaatttagcttatcaagcagcgaaattattaaaagagaagtttaat
gtgaaaaaaggcgtatctattactattgaaaaaacgattccagtagcagctggattagcg
ggtggaagtagtgatgcagcagcgacattacgtggtcttaataaattatggaatttaggg
cttacaattgatcagttagcagagcttggcgcagaaattggatcagatgtatcgttttgt
gtatatggtgggacagcaattgccactggaagaggagagcagattgagcacataaaaact
ccaccttcttgttgggttattttagcaaaacctcatattggtgtatctactgctgatgta
tatggaaatttaaagttaaatcgagttacacatccggatgtagataaaatggtagatgtc
ataaatgctggagactacaaagggatttgtgataatgttggtaatgttttagaagatgta
acgtttgcgatgcatcctgaagttgcacgtattaaggcacagatgaagcgatttggagca
gatgctgtattaatgagtggaagtggtccaactgtattcggcttagtgcaccatgattcg
cgaatgcatcgtatatataacggattaaaaggattttgtgaacaagtatacgcagtacgt
ttattaggagagcgagaaacgcttgaataa

DBGET integrated database retrieval system