KEGG   Bacillus thuringiensis serovar finitimus YBT-020: YBT020_02740Help
Entry
YBT020_02740      CDS       T01839                                 

Definition
(GenBank) glutaminase
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
btf  Bacillus thuringiensis serovar finitimus YBT-020
Pathway
btf00220  Arginine biosynthesis
btf00250  Alanine, aspartate and glutamate metabolism
btf00471  D-Glutamine and D-glutamate metabolism
btf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:btf00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    YBT020_02740
   00220 Arginine biosynthesis
    YBT020_02740
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    YBT020_02740
Enzymes [BR:btf01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     YBT020_02740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaminase TIMELESS
Motif
Other DBs
NCBI-ProteinID: ADY19798
UniProt: F0PXH3
Position
complement(569040..569969)
Genome map
AA seq 309 aa AA seqDB search
MQCIETNNLQQLLEQVKPYTKKGKLATYIPELGNANPDDLGIAIFHKETEYIHAGNSQTL
FTLQSISKVITLALALLDRGEEYVFSKVGMEPTGDPFNSIIKLETTSPSKPLNPMINAGA
LAITSMLAGKDNEEKMERILHFVREITDNPTINYSSKVANSELETAYLNRSLCYYMKQNG
IIDCDIEELMDLYTRQCAVEVNCIDLARIGLIFAMDGYDPYKEKQIIPKHITKICKTFMV
TCGMYNESGEFAIRVGIPAKSGVAGGIFGCVKGEMGIGIFGPALDANGNSIAGFKILELL
SAQEGWSIF
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgcagtgcattgagacaaacaacttacaacagttgttagaacaagtaaaaccatatacg
aaaaaaggaaagcttgctacttatatccccgaactaggaaatgccaatccagatgattta
gggattgccatttttcataaagaaacagaatacatccatgctggcaactcacaaacacta
ttcactcttcaaagtatttcaaaagtaattacacttgcacttgcccttttagatcgtggt
gaagaatatgtattttctaaagttggaatggaaccaaccggtgatccatttaattctatt
attaaattagaaacgacaagtccttctaaaccacttaatccaatgattaatgcaggggca
ctagccattacaagcatgttagcaggtaaagataatgaagaaaaaatggagcgcattctt
catttcgtacgtgaaataacagataatcctactattaattattcttctaaagttgcgaat
tcagaattagagacagcttacttaaatcgttcactttgttactatatgaaacaaaacgga
attattgattgtgatatcgaagaactgatggatttatacactcgtcaatgtgcagttgag
gtaaactgtatcgatttagcacgtatcggtttaatttttgcaatggatggatatgatcca
tataaggaaaaacaaattatccctaagcatattacaaagatttgtaaaacatttatggtt
acatgcggtatgtataacgagtctggtgaatttgcgattcgtgttggtatccccgcaaaa
agtggtgtagctggtggcattttcggctgtgtaaaaggcgaaatgggaattggtattttc
ggaccagctttagatgcaaacggaaatagtatcgctggttttaaaattcttgaacttctt
tctgctcaagaaggttggagcattttttaa

DBGET integrated database retrieval system