KEGG   Bacillus thuringiensis serovar finitimus YBT-020: YBT020_03640Help
Entry
YBT020_03640      CDS       T01839                                 

Definition
(GenBank) zinc-containing alcohol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
btf  Bacillus thuringiensis serovar finitimus YBT-020
Pathway
btf00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:btf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    YBT020_03640
Enzymes [BR:btf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     YBT020_03640
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     YBT020_03640
    1.1.1.-  
     YBT020_03640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_N_assoc 2-Hacid_dh_C TrkA_N Gp_dh_N
Motif
Other DBs
NCBI-ProteinID: ADY19975
UniProt: F0PIT4
Position
776620..777672
Genome map
AA seq 350 aa AA seqDB search
MKALLWHNQRDVRVEEVPEPTVKPGAVKIKVKWCGICGTDLHEYLAGPIFIPTEEHPLTH
VKAPVILGHEFSGEVVEIGEGVTSHKVGDRVVVEPIYSCGKCEACKHGHYNVCEQLVFHG
LGGEGGGFSEYTVVPEDMVHHIPDEMTYEQGALVEPAAVAVHAVRQSKLKEGEAVAVFGC
GPIGLLVIQAAKAAGATPVIAVELSKERQELAKLAGADYVLNPATQDVLAEIRNLTNGLG
VNVSFEVTGVEVVLRQAIESTSFEGQTVIVSVWEKDATITPNNLVLKEKEVVGILGYRHI
FPAVIKLISSGQIQAEKLITKKITVDQVVEEGFEALVKDKTQVKILVSPK
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcattactttggcataatcaacgtgatgtaagagtagaagaagtaccagaacca
actgtaaaaccaggagcagttaagattaaagtgaaatggtgtggtatctgcgggacagac
ttgcatgaatatttagcaggacctatttttattccgacagaagagcatccattaacacat
gtaaaagcaccggttattttaggtcatgagtttagcggtgaggtagttgaaatcggtgaa
ggcgttacatctcataaagtgggagatcgcgtcgttgtagaaccaatttattcttgtggt
aaatgtgaagcttgtaaacatggacattacaatgtttgtgaacaacttgttttccacggt
cttggcggagaaggcggcggtttctctgaatatacagtagtaccagaagatatggttcac
catattccagatgaaatgacgtatgaacaaggtgctcttgtagaaccagcagcagtagcg
gttcatgcagtacgtcaaagtaaattaaaagaaggggaagctgtagcagtatttggttgt
ggtccaattggacttcttgttatccaagcagctaaagcagcaggagcaactcctgttatt
gcagttgaactttctaaagaacgtcaagagttagcaaaattagcaggtgcggattacgta
ttaaatccagcgactcaagatgtattagctgaaattcgcaacttaacaaatggtttaggt
gtaaatgtaagctttgaagtaacaggtgttgaagtagtacttcgtcaagcaattgaaagc
acaagctttgaaggacaaactgtaattgttagtgtatgggaaaaagacgcaacaattact
ccaaataatcttgtgctaaaagaaaaagaagtggttggtattttaggataccgtcatatc
ttcccagctgttattaaattaattagctctggtcaaattcaagcagagaaattaattacg
aaaaaaatcacagtagatcaagttgttgaagaaggatttgaagcacttgtaaaagataaa
acacaagtgaaaattcttgtttcacctaaataa

DBGET integrated database retrieval system