KEGG   Bacillus thuringiensis serovar finitimus YBT-020: YBT020_06865Help
Entry
YBT020_06865      CDS       T01839                                 

Definition
(GenBank) tryptophan synthase subunit beta
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
btf  Bacillus thuringiensis serovar finitimus YBT-020
Pathway
btf00260  Glycine, serine and threonine metabolism
btf00400  Phenylalanine, tyrosine and tryptophan biosynthesis
btf01100  Metabolic pathways
btf01110  Biosynthesis of secondary metabolites
btf01130  Biosynthesis of antibiotics
btf01230  Biosynthesis of amino acids
Module
btf_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:btf00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    YBT020_06865
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    YBT020_06865
Enzymes [BR:btf01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     YBT020_06865
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ADY20619
UniProt: F0PSC6
Position
1378077..1379270
Genome map
AA seq 397 aa AA seqDB search
MNYAYPDEKGHYGIYGGRYVPETLMQSVLELEEAYKEAMEDEAFQKELNHYLKTYVGRET
PLYFAENMTEYCGGAKIYLKREDLNHTGAHKINNTIGQALLAVRMGKKKVVAETGAGQHG
VATATVCALLGLECVIFMGEEDVRRQKLNVFRMELLGAKVESVAAGSGTLKDAVNEALRY
WVSHVHDTHYIMGSVLGPHPFPQIVRDFQSVIGKETKKQYEALEGKLPEAVVACIGGGSN
AMGMFYPFVHDEEVALYGVEAAGKGVHTEKHAATLTKGSVGVLHGSMMYLLQNEEGQIQE
AHSISAGLDYPGVGPEHSLLKDIGRVSYHSITDDEALEAFQLLTKKEGIIPALESSHAVA
YALKLAPQMKEDEGLVICLSGRGDKDVESIKRYMEEV
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgaactacgcatatccagatgaaaaaggtcactacggtatatacggaggacgatacgtt
ccagaaacgttaatgcaatctgtattagaactagaagaagcatataaagaggcgatggaa
gatgaagcatttcaaaaggaattaaatcattatttaaaaacgtatgtcggaagagaaaca
ccgctttatttcgctgagaatatgacggagtattgcggaggtgcaaagatttatttaaaa
cgtgaagatttgaaccatacaggagctcataaaattaataatacaattggtcaggcactt
cttgcggtgcgaatgggcaagaaaaaagttgtcgctgaaacaggggctggacaacacggt
gttgcaacagctacggtatgtgcccttctcggtttagagtgcgtcatctttatgggagaa
gaagatgtgagacgtcaaaaattaaacgtgttccgaatggaattactcggagcgaaagta
gaaagtgtagcggcaggtagcggtacattaaaagatgcggtaaacgaggcgcttcgttac
tgggtttcacacgtgcatgatacgcactacattatgggatctgttctcggaccacatcca
ttcccgcaaattgttcgtgatttccaaagtgtaattggaaaagaaacgaaaaaacaatat
gaagcgttagaaggaaagttaccagaagcagtcgttgcttgcattggtggtgggagtaac
gcaatgggaatgttttatccgttcgtacacgatgaagaagttgctctttacggcgtagaa
gcagctggaaaaggtgttcatacagaaaagcatgcagcaactttaacgaaaggaagcgtc
ggtgttttacacggatcgatgatgtatcttctgcaaaatgaagaaggtcaaattcaagaa
gcgcactctatttcagcagggcttgattacccgggagttggtccagaacatagcttgcta
aaagatattggccgcgtttcttatcattccattactgatgatgaggcgttagaagcgttt
cagttattaacgaaaaaagaagggattatcccggcattagaaagctcgcatgctgtcgca
tacgcattaaaattagcgccgcaaatgaaggaagatgaaggacttgtcatttgtttatcc
ggccgtggtgataaagatgtagagagtataaaacgttatatggaagaggtgtaa

DBGET integrated database retrieval system