KEGG   Bacillus thuringiensis serovar finitimus YBT-020: YBT020_06945Help
Entry
YBT020_06945      CDS       T01839                                 

Definition
(GenBank) dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
btf  Bacillus thuringiensis serovar finitimus YBT-020
Pathway
btf00020  Citrate cycle (TCA cycle)
btf00310  Lysine degradation
btf01100  Metabolic pathways
btf01110  Biosynthesis of secondary metabolites
btf01120  Microbial metabolism in diverse environments
btf01130  Biosynthesis of antibiotics
btf01200  Carbon metabolism
Module
btf_M00009  Citrate cycle (TCA cycle, Krebs cycle)
btf_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:btf00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    YBT020_06945
  Amino acid metabolism
   00310 Lysine degradation
    YBT020_06945
Enzymes [BR:btf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     YBT020_06945
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N Orai-1
Motif
Other DBs
NCBI-ProteinID: ADY20635
UniProt: F0PSE2
Position
complement(1395560..1396816)
Genome map
AA seq 418 aa AA seqDB search
MIEIKVPELAESITEGTISQWLINVGDKVEKGGSVVELETDKVNVEIIAEDSGIVSKLLG
EPGDTVEVGATIAILDANGAPVAVSTPAPAEQPKQETAEAPKAAAPSAEQTATLQGLPNT
NRPIASPAARKMARELGIDLNDVRSTDPLGRVRPHDVQAHAAAPKEAPAAPKSPAPAPVA
KTEFEKPVERVKMSRRRQTIAKRLVEVQQTSAMLTTFNEVDMTAIMELRKERKDAFEKKH
DVRLGFMSFFTKAVVAALKQFPLLNAEIQGDELIIKKFYDIGIAVAAPDGLVVPVVRDAN
QLNFAEIESEIRELGKKARDNKLSLKELQGGTFTITNGGVFGSLMSTPILNSPQVGILGM
HKIQVRPVAIDNERMENRPMMYIALSYDHRIVDGKEAVSFLVAVKDMLEDPKSLLLEG
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgatcgaaattaaagtacctgagcttgcagaatctattactgaaggaactatctcacaa
tggcttatcaacgtaggcgacaaagttgagaaaggtggcagcgttgttgagcttgaaact
gataaagtcaatgtagaaatcattgcagaagattcaggtattgtatcgaagttactaggc
gaacctggggatacagttgaagttggcgcaactatcgcaattttagacgcaaacggagca
ccagttgcagtaagtacacctgcaccggctgagcaaccgaaacaagaaactgctgaagca
ccaaaagctgcggcaccaagtgctgaacaaactgcaactttacaaggtttaccaaataca
aaccgtcctatcgcatcaccagctgctagaaaaatggctcgtgaattaggaatcgactta
aacgacgtacgtagcacagatccacttggccgtgtgagaccacacgatgtacaagctcat
gctgcagcaccaaaagaagcaccagctgctccaaaaagtccagctcctgctccagttgca
aaaactgaattcgaaaaaccagttgagcgcgtgaaaatgtcccgccgccgtcaaacaatt
gcaaaacgtcttgtagaagttcaacaaacatctgcaatgttaacaacatttaacgaagtt
gatatgactgcaatcatggaattacgtaaagagcgtaaagatgctttcgagaaaaaacat
gatgtacgtcttggtttcatgtcattcttcacaaaagcagttgttgcagcattaaaacaa
ttcccattattaaatgctgaaattcaaggcgacgagcttatcattaaaaaattctatgat
atcggtattgcagtagcagctccagatggattagttgttccagttgtacgcgatgcgaac
caattaaacttcgctgaaatcgaaagcgaaattcgtgaattaggtaaaaaagcacgtgat
aacaaactttcattaaaagaactacaaggtggtacatttacaattacaaacggtggtgtg
ttcggttctctaatgtcaacaccgatcctaaacagcccacaagttggtattttaggaatg
cacaaaatccaagtacgtccagttgcaatcgataacgaacgtatggaaaaccgcccaatg
atgtatatcgctttatcttacgatcaccgtattgttgatggtaaagaagcagttagcttc
cttgttgctgttaaagatatgcttgaagatccaaaatcattattattagaaggttga

DBGET integrated database retrieval system