KEGG   Bacillus thuringiensis serovar finitimus YBT-020: YBT020_07545Help
Entry
YBT020_07545      CDS       T01839                                 

Definition
(GenBank) aminoglycoside phosphotransferase family protein
  KO
K17910  aminoglycoside 2''-phosphotransferase [EC:2.7.1.190]
Organism
btf  Bacillus thuringiensis serovar finitimus YBT-020
Brite
KEGG Orthology (KO) [BR:btf00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   01504 Antimicrobial resistance genes [BR:btf01504]
    YBT020_07545
Enzymes [BR:btf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.190  aminoglycoside 2''-phosphotransferase
     YBT020_07545
Antimicrobial resistance genes [BR:btf01504]
 Gene variants
  Aminoglycoside resistance genes
   O-Phosphotransferases
    YBT020_07545
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: APH DUF1679
Motif
Other DBs
NCBI-ProteinID: ADY20755
UniProt: F0PTK9
Position
complement(1499382..1500284)
Genome map
AA seq 300 aa AA seqDB search
MDSYKQYIKEALPNLSIHSYKQNEEGWDNVAVIVNDELLFRFPRKQEYAMRIPLEKELCT
ILTQSLQEIEVPQYHLIYKNESDEVPLCSYYTLIHGEPLKTEIVANLDEKERKIIITQLA
TFLAALHSIPLKSVTALGFPTEKTLTYWKELQTKLNEYVTNSLTSFQKSTLNRLFENFFA
CIATSVFPNAIIHADFTHHHILFDNQNKTISGIIDFGDAQIGDPAFDFAGLYDDFGHEFT
TSVYEQYCTLTSHHDPLLIHRITNFYQYSPLLHNIIYNFETKNELEFLAGIEQLKVILQG
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atggactcttacaaacaatatataaaagaagctttgcctaatctttctatacactcatat
aaacaaaatgaagaaggatgggataatgtagcggttattgtaaatgatgaactactgttt
cgtttcccgcgaaaacaggaatatgcaatgcgaattccgttagaaaaagaactgtgcaca
attctcactcaatcactacaagaaatcgaagttccacaatatcacctaatttataaaaat
gaatctgatgaggttcctctttgtagttactatactctcattcatggtgaaccattaaaa
acagaaatagttgcgaacttagatgaaaaagaacgaaaaataattattacacaattagct
actttccttgcggctctacatagcattcctctaaaaagtgttacagcgttagggttccct
accgaaaaaacacttacctactggaaagagctacaaactaaattaaatgagtatgttact
aacagtctaacttcgttccagaaatcaaccttaaaccgtttattcgagaatttttttgcc
tgtatagctacatcggtatttccaaatgcaatcattcacgctgactttacacatcatcac
attttatttgataaccaaaataaaaccatttcaggaatcattgattttggtgatgctcaa
attggagatcctgcctttgactttgctgggctatatgatgatttcggacatgaatttact
acatcagtatatgaacaatactgtacacttacttcacaccatgatccattactcattcac
cgtatcacaaatttttatcaatacagtcctttactacataatataatttataactttgaa
acaaagaatgaacttgagtttttagctggtatagaacaactgaaagtaatactgcaggga
tga

DBGET integrated database retrieval system