KEGG   Bacillus thuringiensis serovar finitimus YBT-020: YBT020_07680Help
Entry
YBT020_07680      CDS       T01839                                 

Gene name
hisD
Definition
(GenBank) bifunctional histidinal dehydrogenase/histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
btf  Bacillus thuringiensis serovar finitimus YBT-020
Pathway
btf00340  Histidine metabolism
btf01100  Metabolic pathways
btf01110  Biosynthesis of secondary metabolites
btf01230  Biosynthesis of amino acids
Module
btf_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:btf00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    YBT020_07680 (hisD)
Enzymes [BR:btf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     YBT020_07680 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: ADY20782
UniProt: F0PUJ5
Position
1523576..1524865
Genome map
AA seq 429 aa AA seqDB search
MEIVFEDFQKALSKIKLLRENANIIEETVQRSVSEIVQNVRESRDDALSFYTKKFDGVKM
KEFRVSEEEIKRASMFVENSFLEALQEAKKNIISYHEKQKRQSMFDCASKGIIRGQIIRP
LENVGVYVPGGTASYPSSVLMNVLPAKLAGVKKIVMVTPPREGEIDPHILVAASLAGVDE
IYTIGGAQAIAALAYGTESIPKVDKIVGPGNLYVALAKREVYGIVNIDMIAGPSEIVVIA
DETGNAKYIAADLLSQAEHDERATAICITTNIDLAKEVEKEIERQLETLPRSEIARESIK
RNGAIFIVPSLDEALKLSNEIAPEHLELHIKEPMNALAYVKHAGSIFLGPYAPEPLGDYL
AGPNHVLPTSGTARFFSPLSVDDFVKKSSFLSYTEEALRDVQHHIVELANKEGLHAHARA
IQIRFEEEE
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atggagatcgtttttgaagattttcaaaaggctttatcgaaaataaaattactacgagaa
aatgccaatataatagaagaaactgttcaaagaagtgtaagtgaaatcgttcaaaatgta
agggagagtagggatgatgccttatctttttatacaaaaaagtttgatggtgtaaagatg
aaagagtttcgtgtaagtgaagaagaaataaaacgagcgagtatgtttgtagagaattca
tttttagaagcgttacaagaggcgaagaaaaacattatttcgtaccatgaaaagcaaaaa
agacaatccatgttcgattgcgcgagtaaaggtatcattagaggacaaatcattcggccg
ttagagaatgtaggagtatatgtgccaggcggaactgcttcgtatccttcgtcagtatta
atgaatgtattgccagcaaaactcgctggtgtgaaaaagattgtaatggtaacaccgcca
agagaaggagaaattgatccacatattttagttgctgcaagccttgcaggagtagatgaa
atttatacgataggtggtgcgcaagcaattgctgctttagcatacgggacggaatcgatt
ccgaaagtggataaaatagttggaccaggaaatttgtacgtcgctttagcgaaacgagaa
gtatatggaatagtaaatatcgatatgattgctggaccgtcagaaattgtagttattgca
gatgaaaccggcaatgcaaaatatattgctgctgatttattatcacaagcagaacatgac
gagagagcgacagcaatttgtattacaacaaatatagatttagcaaaagaagtagaaaaa
gagatagaaaggcagttagaaacattaccaagaagcgaaattgcacgtgaatcaataaag
agaaatggagccatttttatcgttccttctttagatgaggcgctaaagttatcgaatgaa
attgccccggaacatttagagttacatataaaagaaccgatgaatgctctagcttatgtg
aaacatgcaggatctatctttcttggaccatatgcaccagaaccgctcggggattattta
gcaggaccgaatcacgtgttaccgacaagtggaacggcaaggtttttctcaccgttatca
gtcgatgattttgtgaaaaaatcaagctttctgtcttatacggaggaagcattaagagat
gtccaacatcatattgtagagcttgccaataaagaagggttacatgcgcatgcgagagcg
attcaaataagatttgaggaggaagaataa

DBGET integrated database retrieval system