KEGG   Bacillus thuringiensis serovar finitimus YBT-020: YBT020_09730Help
Entry
YBT020_09730      CDS       T01839                                 

Definition
(GenBank) acetyl-CoA hydrolase
  KO
K18118  succinyl-CoA:acetate CoA-transferase [EC:2.8.3.18]
Organism
btf  Bacillus thuringiensis serovar finitimus YBT-020
Pathway
btf00020  Citrate cycle (TCA cycle)
btf00620  Pyruvate metabolism
btf00650  Butanoate metabolism
btf01100  Metabolic pathways
btf01110  Biosynthesis of secondary metabolites
btf01120  Microbial metabolism in diverse environments
btf01130  Biosynthesis of antibiotics
btf01200  Carbon metabolism
Module
btf_M00009  Citrate cycle (TCA cycle, Krebs cycle)
btf_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:btf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    YBT020_09730
   00620 Pyruvate metabolism
    YBT020_09730
   00650 Butanoate metabolism
    YBT020_09730
Enzymes [BR:btf01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.18  succinyl-CoA:acetate CoA-transferase
     YBT020_09730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetylCoA_hyd_C AcetylCoA_hydro CitF LUD_dom CoA_trans
Motif
Other DBs
NCBI-ProteinID: ADY21192
UniProt: F0PIX5
Position
1916507..1918021
Genome map
AA seq 504 aa AA seqDB search
MENNLDRIRDERLKDRVVTPEEAASWIESGMTLGLSGFTRAGDVKAVPFALVNRVKNDTS
FKVNVYTGASLGSDVDKLFAEAGILGKRLPFQADATMRKGINNGDFLFVDQHLSHTSELL
RADVMDVDFAILEAVAITEDGMIIPTTSIGNSLAFSLNAKSIIIEMNMAQSTQLEGLHDL
YEPGKQGERLPIPIVKTDDRIGTIGIPIDVEKVKGIVFTNQLDSPSTIVPPDEETVIMAQ
HLIEFLRKEVEVGRLTNRLAPLQSGIGSVANAVLHGMLDSEFEDLEVYSEVLQDAVFDLM
DAGKVNFASCCSITLSEEKMQKVFSNFEKYRDKLMMRPQEISNHPEIIRRLGLISINTAL
ELDIYGNVNSTHVLGTKMMNGIGGSGDFARNARLAIFVTKSIAKGGNISSIVPFVSHVDH
TEHDVDVIVTEQGYVDLRGLAPRERVELIIENCAHPMYRDQLRAYYEEAKTRGGQTPHVL
EKAFSWHMNYAKNGTMLEAVVETV
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atggagaataatttggatagaattagggatgaacgtctgaaagatcgcgtagttacacct
gaagaagcagcttcatggattgaaagtggaatgactttaggcttaagtgggtttacacgt
gcaggtgatgtaaaagcagtcccatttgcgcttgtaaaccgagttaagaatgatacatct
tttaaagtaaatgtttatactggtgcctctttaggttctgatgtagataaattatttgcg
gaagcaggaattttagggaaaagattgcctttccaagctgatgcgactatgcgaaaagga
attaataacggagattttttatttgtggaccagcacttatctcatacatcagagttactt
cgcgctgacgttatggatgtagattttgctattttggaagcggttgcgattactgaagat
ggcatgattattccaacaacttcaataggaaattctttagcgttttctttaaatgctaag
tccattattattgaaatgaatatggctcaatccacgcagttagaaggactgcatgattta
tatgaaccaggtaaacaaggagaaagacttccaattccgattgtgaaaacggatgatcga
attggaacgattggcattccaatcgatgttgaaaaggtgaaagggattgtgtttacgaac
caattagactcaccatcgacaattgttcctccggatgaagaaactgttattatggcccag
catttaatagagttccttcgaaaagaagtcgaagtaggccgattaacaaatcgtttagca
ccgttacaatcaggaattggctcagtggctaatgctgttcttcatggaatgttagattcg
gagtttgaagatttagaagtgtattctgaagttttacaagatgcggtctttgatcttatg
gatgctggaaaagtcaattttgcttcatgctgttcaatcacactctctgaggagaaaatg
caaaaagtattttccaactttgaaaaatatcgtgacaaattaatgatgcgcccgcaagag
atttctaatcatcctgaaatcattcgtcgcctcggattaatctcgattaatactgcttta
gaattagatatatacggaaatgtgaactctactcacgttttaggcacaaaaatgatgaat
ggtatcggtggttctggtgattttgcgagaaatgctcgcctagctatctttgttacgaaa
tcgattgcgaaaggtggtaacatttcaagtatcgttccttttgtttcacatgtggaccat
acggaacacgatgtagatgttatcgtcactgaacaagggtatgttgatctaagaggactg
gccccaagagaaagagtggaattaattatagagaattgcgcacatccaatgtatcgtgat
cagctaagagcttattacgaagaagctaaaacgagaggtggacaaactcctcatgtttta
gaaaaagctttttcttggcatatgaattatgctaaaaatggaacaatgcttgaagcagta
gtagaaactgtatag

DBGET integrated database retrieval system