KEGG   Bacillus thuringiensis serovar finitimus YBT-020: YBT020_10250Help
Entry
YBT020_10250      CDS       T01839                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
btf  Bacillus thuringiensis serovar finitimus YBT-020
Pathway
btf00260  Glycine, serine and threonine metabolism
btf00750  Vitamin B6 metabolism
btf01100  Metabolic pathways
btf01110  Biosynthesis of secondary metabolites
btf01120  Microbial metabolism in diverse environments
btf01230  Biosynthesis of amino acids
Module
btf_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:btf00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    YBT020_10250
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    YBT020_10250
Enzymes [BR:btf01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     YBT020_10250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP PK_C
Motif
Other DBs
NCBI-ProteinID: ADY21296
UniProt: F0PJU6
Position
2026186..2027244
Genome map
AA seq 352 aa AA seqDB search
MYKGLLKQYASYLPVNENTPDVSLMEGNTPLIPLLNISKQLGIQLYGKYEGANPTGSFKD
RGMVMAVAKAKEEGSEAIICASTGNTSASAAAYAARLGMKCIIVIPEGKIAHGKLAQAVA
YGAEIISIEGNFDDALKAVRNIAAEEPITLVNSVNPYRIEGQKTAAFEICDQLQSAPDVL
AIPVGNAGNITAYWKGFCEYEKEKGYKKPRIHGFEAEGAAAIVKGHVIDEPETIATAIRI
GNPASWSYAVEAAEQSHGEIDMVSDEEILHAYRLLAKSEGVFAEPGSNASLAGVMKHVQS
GKIKKGETVVAVLTGNGLKDPDIAISSNTLDIASVSNNIEQIKEHIKGVIMS
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgtataaaggattattaaaacagtatgcttcttatttaccggtcaatgaaaatacacct
gatgtgagcttaatggaagggaatacaccacttatcccgttattaaatatatcaaaacaa
ttaggaattcagttatacggtaagtatgaaggagcgaatccgacaggttcttttaaagat
cgaggtatggtaatggcagttgcaaaggcgaaagaagaagggtcagaggccattatttgt
gcatcaactggtaatacatcagcatcggccgcagcatatgcggcacgccttggaatgaaa
tgtattatcgtaatcccagaagggaaaattgcacatggaaaattagcgcaagcagtcgct
tacggagctgaaattatttcaatagaagggaattttgatgatgcacttaaggctgtaaga
aatattgctgcggaagagccaatcacattagttaactcggtaaatccttatcgaattgaa
gggcaaaaaacagcagcatttgaaatttgtgatcaattacaaagtgcaccagatgtgtta
gcaattcctgttggaaatgctggaaatattacagcatactggaaaggtttctgtgaatat
gaaaaagaaaaaggctataagaagccaagaattcatggatttgaagcggaaggagcagct
gctattgtaaaagggcatgtaattgacgagccagaaacaattgcaacagcgattcgcatc
ggtaacccagcaagttggtcatatgcagtagaggctgctgagcaatctcacggtgaaata
gatatggtatcagatgaagaaattttacatgcgtatagattattagcaaaatcggaaggg
gttttcgctgagccaggatcaaatgcttcattagctggcgtaatgaaacatgttcaatct
ggaaaaatcaaaaaaggagaaacagttgttgcagttttaactggaaacggcttgaaagat
cctgatatcgcaatctcttctaatacattagatattgcaagtgtttcaaataatatagaa
caaattaaagagcatattaaaggggtgattatgtcgtga

DBGET integrated database retrieval system