KEGG   Bacillus thuringiensis serovar finitimus YBT-020: YBT020_15655Help
Entry
YBT020_15655      CDS       T01839                                 

Definition
(GenBank) alcohol dehydrogenase zinc-binding domain protein
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
btf  Bacillus thuringiensis serovar finitimus YBT-020
Pathway
btf00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:btf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    YBT020_15655
Enzymes [BR:btf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     YBT020_15655
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     YBT020_15655
    1.1.1.-  
     YBT020_15655
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C ADH_zinc_N_2 ADH_N_assoc AlaDh_PNT_C Cas_csx3
Motif
Other DBs
NCBI-ProteinID: ADY22361
UniProt: F0PYU1
Position
complement(3048491..3049513)
Genome map
AA seq 340 aa AA seqDB search
MKAAVWYGERDIRIEERAVKELQPNDVKVKVAWAGICGSDLHAYLHPDSVPMNKNMIIGH
EFSGEIAEVGSHVTKFKEGDRVCIYPMMLKDPSNAETERFITLDAVGAHTDGGFAEYVTL
PEKTIFKIPDNLPLEVAAMVEPAAVSFQSIKDSNVKEGDTVVVYGAGPIGLFAVLGAKAA
GASNIIVVDLLDSRLDKATEMGATHVFNVKEVNPVEEIRKLFPDGADVTVEAAGVESTFN
QAIQSTKVRGTMMVISFHTQNIQFNAPASLIFSGVKLMGSVGYSNETYNEVIELLANGGL
PVQSIITSKVDIDNIAEQGFEALIHDKSQAKILVKLSGAH
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctgcagtgtggtatggcgaaagagatattcgtattgaggaaagagcagtgaaa
gaattacaacctaatgatgtaaaagttaaagtagcatgggctggtatttgtgggtctgat
ttacacgcatatttgcatccagattcagtaccgatgaataagaatatgataattggacat
gaattttctggtgaaattgcagaggttggttctcatgtaacaaaatttaaagaaggtgac
agagtgtgtatctatccaatgatgcttaaagatccttcgaatgctgaaacggaacgtttc
atcactttagatgcggttggtgcacatactgatggaggatttgctgaatacgtgacactt
ccggaaaaaacgatttttaaaattccagataatttaccactagaagtagcagcaatggtt
gaaccagcagctgtatctttccaatcaattaaggattcaaatgtaaaagaaggtgatact
gttgttgtctatggagcgggtccaattgggttatttgctgtattaggtgcaaaagctgca
ggcgcttctaatattattgttgtcgatttattggatagtcgactcgataaagcaactgaa
atgggtgcaacacatgtctttaatgttaaagaagtgaatcctgttgaagaaattcgtaaa
ttattcccagatggagcagatgttacagttgaagctgcaggtgttgagtcaacatttaat
caagctattcaatcaactaaagttcgtggcacaatgatggttatcagcttccacacgcaa
aatatccagtttaatgctcctgcttcactaatttttagtggtgtaaaattaatggggtct
gtaggatacagtaatgaaacttacaatgaggtcattgaattacttgctaatggaggatta
ccggtgcaatcaattattacaagtaaagttgatatagataatatcgctgaacaaggcttt
gaagcgttaattcatgataagtctcaagcaaaaattctagttaaattaagtggcgcacat
taa

DBGET integrated database retrieval system