KEGG   Bacillus thuringiensis serovar finitimus YBT-020: YBT020_16455Help
Entry
YBT020_16455      CDS       T01839                                 

Definition
(GenBank) HAD superfamily hydrolase
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
btf  Bacillus thuringiensis serovar finitimus YBT-020
Pathway
btf00361  Chlorocyclohexane and chlorobenzene degradation
btf00625  Chloroalkane and chloroalkene degradation
btf01100  Metabolic pathways
btf01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:btf00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    YBT020_16455
   00361 Chlorocyclohexane and chlorobenzene degradation
    YBT020_16455
Enzymes [BR:btf01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     YBT020_16455
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like HAD PGP_phosphatase
Motif
Other DBs
NCBI-ProteinID: ADY22521
UniProt: F0PK12
Position
complement(3213111..3213821)
Genome map
AA seq 236 aa AA seqDB search
MKYKVILFDVDDTLLDFPETEKHALHNAFVQFGMPTGYSDYLASYKEISNGLWTDLENKM
ITLSELAVDRFRQLFALHNIEVDAQQFSDVYLENLGKEVHLIEGAVQLCENLQDCKLGII
TNGYTKVQQSRIGNSPLSNFFDHIIISEEVGHQKPAREIFDYAFEKFGITDKSSVLMVGD
SLTSDMRGGEDYGIDTCWYNPSLKENKASVKPTYEVESLLQILELVEVAEEKVVSF
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgaaatataaagttatattattcgacgtagacgatacattattagattttcctgaaacg
gaaaaacacgcattacataatgcgtttgtacagtttggtatgcctacagggtatagtgat
tatcttgcaagttataaagagattagtaatgggctatggacagatttagaaaataaaatg
attacgttaagtgaattagcggtagatcgatttagacaattatttgcacttcataatata
gaagtagatgcgcagcaatttagtgatgtatatcttgaaaacttaggaaaagaagtgcat
cttattgagggcgcagtgcaattatgtgagaatctacaagattgcaagctaggcatcatt
acgaatggatatacgaaggtacaacaatctagaattggaaattcgcctttaagtaacttc
tttgatcatattattatttctgaagaggttggccatcaaaaaccagcacgtgagattttt
gattatgcatttgaaaagtttgggattacggataaatcaagtgtactaatggttggagat
tcgctcacttctgatatgagaggcggagaagattacggcattgatacgtgttggtataat
ccgagtttgaaagagaataaggcaagtgttaagccgacttatgaagtggagagtctgctg
caaattttagaacttgtagaagtggcggaagaaaaggtagtttcattttaa

DBGET integrated database retrieval system