KEGG   Bacillus thuringiensis serovar finitimus YBT-020: YBT020_17775Help
Entry
YBT020_17775      CDS       T01839                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
btf  Bacillus thuringiensis serovar finitimus YBT-020
Pathway
btf00071  Fatty acid degradation
btf00072  Synthesis and degradation of ketone bodies
btf00280  Valine, leucine and isoleucine degradation
btf00310  Lysine degradation
btf00362  Benzoate degradation
btf00380  Tryptophan metabolism
btf00620  Pyruvate metabolism
btf00630  Glyoxylate and dicarboxylate metabolism
btf00640  Propanoate metabolism
btf00650  Butanoate metabolism
btf00900  Terpenoid backbone biosynthesis
btf01100  Metabolic pathways
btf01110  Biosynthesis of secondary metabolites
btf01120  Microbial metabolism in diverse environments
btf01130  Biosynthesis of antibiotics
btf01200  Carbon metabolism
btf01212  Fatty acid metabolism
btf02020  Two-component system
Brite
KEGG Orthology (KO) [BR:btf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    YBT020_17775
   00630 Glyoxylate and dicarboxylate metabolism
    YBT020_17775
   00640 Propanoate metabolism
    YBT020_17775
   00650 Butanoate metabolism
    YBT020_17775
  09103 Lipid metabolism
   00071 Fatty acid degradation
    YBT020_17775
   00072 Synthesis and degradation of ketone bodies
    YBT020_17775
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    YBT020_17775
   00310 Lysine degradation
    YBT020_17775
   00380 Tryptophan metabolism
    YBT020_17775
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    YBT020_17775
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    YBT020_17775
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    YBT020_17775
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:btf04147]
    YBT020_17775
Enzymes [BR:btf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     YBT020_17775
Exosome [BR:btf04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   YBT020_17775
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ADY22785
UniProt: F0PMU4
Position
complement(3470884..3471975)
Genome map
AA seq 363 aa AA seqDB search
MNRAVVVEAKRTPIGKKNGMLKDYEVQQLAAPLLTFLSKGMERAIDDVILGNVVGPGGNV
ARLSALEAGLSHHIPGVTIDRQCGAGLEAIRTACHFIQGGAGKCYIAGGVESTSVSPFQN
RARFSPETIGDPNMGVAAEYVAERYNITREMQDEYACLSYKRTLQALEKGYIHDEILSFH
GLLDESIKPEMNYERIIKRTKPAFLQNGTVTAGNSCGVNDGACAVLVMEEGQARKLGYKP
VLRFVRSAVVGVDPNLPGTGPIFAVNKLLNERNMKVEDIDYFEINEAFASKVVACAKELQ
IPYEKLNVNGGAIALGHPYGASGAMLVTRLFYQAKRERMKYGIATLGIGGGIGLALLFEK
VED
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgaatagagcagttgttgtagaagcgaaaaggacacctattggtaagaagaatgggatg
ttaaaagactatgaagttcagcaattagcagcgccgcttcttacatttttaagtaaagga
atggagagagcaatagacgatgtcatattagggaatgttgttgggccaggagggaatgtt
gcgagattatctgctttagaagcagggcttagtcatcatattccgggtgtaacgattgac
cggcaatgtggtgccggattggaagcgattcgcaccgcatgtcatttcattcaagggggg
gccggtaagtgctatatcgccggaggagtagagagtacaagtgtgtcaccttttcaaaat
agggcgcgattttcaccagaaacaattggcgatcctaatatgggagtagcggctgaatat
gttgcagaacgttataacatcacgagagaaatgcaagatgagtatgcttgcctcagttat
aaacgaacactgcaagcattagaaaaaggatatatacatgatgaaatattgtcttttcat
ggattattagatgaatctataaagccagaaatgaattatgaacgaattattaaaagaaca
aaacctgcatttttacaaaatggtacagtaacggcaggtaattcgtgtggtgtcaatgat
ggggcatgtgcagttcttgtaatggaagaggggcaagctcgaaaattaggatataagcct
gtccttcgtttcgttcgtagtgctgtagttggagtagacccaaatcttccggggactggt
ccgatatttgcggtgaacaaattattaaacgaaaggaatatgaaagtagaggacatcgat
tattttgaaataaatgaagcattcgcctcaaaagttgtagcttgtgcaaaggagttacaa
attccgtatgaaaaattaaatgtaaatggtggtgcaattgcgctcggtcatccgtacggt
gcatctggggctatgcttgtaacgcgcttgttttatcaggcgaaacgagagcgtatgaaa
tacggaatcgcgacgttaggaatagggggcgggataggtcttgcattattatttgagaaa
gtagaagactag

DBGET integrated database retrieval system