KEGG   Bacillus thuringiensis serovar finitimus YBT-020: YBT020_19800Help
Entry
YBT020_19800      CDS       T01839                                 

Definition
(GenBank) putative acyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
btf  Bacillus thuringiensis serovar finitimus YBT-020
Pathway
btf00071  Fatty acid degradation
btf00072  Synthesis and degradation of ketone bodies
btf00280  Valine, leucine and isoleucine degradation
btf00310  Lysine degradation
btf00362  Benzoate degradation
btf00380  Tryptophan metabolism
btf00620  Pyruvate metabolism
btf00630  Glyoxylate and dicarboxylate metabolism
btf00640  Propanoate metabolism
btf00650  Butanoate metabolism
btf00900  Terpenoid backbone biosynthesis
btf01100  Metabolic pathways
btf01110  Biosynthesis of secondary metabolites
btf01120  Microbial metabolism in diverse environments
btf01130  Biosynthesis of antibiotics
btf01200  Carbon metabolism
btf01212  Fatty acid metabolism
btf02020  Two-component system
Brite
KEGG Orthology (KO) [BR:btf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    YBT020_19800
   00630 Glyoxylate and dicarboxylate metabolism
    YBT020_19800
   00640 Propanoate metabolism
    YBT020_19800
   00650 Butanoate metabolism
    YBT020_19800
  09103 Lipid metabolism
   00071 Fatty acid degradation
    YBT020_19800
   00072 Synthesis and degradation of ketone bodies
    YBT020_19800
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    YBT020_19800
   00310 Lysine degradation
    YBT020_19800
   00380 Tryptophan metabolism
    YBT020_19800
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    YBT020_19800
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    YBT020_19800
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    YBT020_19800
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:btf04147]
    YBT020_19800
Enzymes [BR:btf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     YBT020_19800
Exosome [BR:btf04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   YBT020_19800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: ADY23188
UniProt: F0PSY7
Position
complement(3882166..3883341)
Genome map
AA seq 391 aa AA seqDB search
MHNVVITAAVRSPIGTFGGALKNVTPVELAVPVLQEAVKRGGVEPHEVDEVILGHCIQRT
DEANTARTAALAAGFPDTVTGYTIQRQCSSGMQAIMSAAMQIQLGVSEVVVAGGVEAMSS
SPYALKQHRWGQRLQHGEIRDTVWEVLEDPIHHIMMGETAENLVEQYEITREEQDEVALR
SHTLALKAIESGYFDDQIVPITIKERRKEVVFSKDEHPRADITAEKLAGLKPAFRKGGSV
TAGNASGLNDGSAVLVLMSEEKAKEKGLQPLARIVGYSVAGVDPKIMGIGPAPAIRKGLE
KVDWSLEDADLLEINEAFAAQYLAVEKELGLDREKVNVNGSGVGLGHPIGCTGARITVSL
IHELKRRGLEKGIASLCVGGGIGVALFIEAL
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgcataatgttgttattacagctgcagttcgttcgccaattggaacttttgggggagcg
ctaaaaaatgtaacgccagtagaattagctgttcctgtacttcaggaagctgtaaaacga
ggcggggtagaaccacacgaagttgatgaagtgattttaggtcattgtattcaaagaact
gatgaagcaaatacggcgagaacggctgcattagcggcagggtttcctgacacagttaca
ggttatacaatccaacgccaatgttcttcaggtatgcaagcaattatgtcggctgcaatg
caaattcaattaggtgtaagtgaagttgtcgttgcaggtggagtagaagcaatgagttca
agcccttatgcattaaaacaacaccgctggggacaacgcctacaacacggagaaattcgt
gatacggtgtgggaagtattagaagatccaattcatcatattatgatgggggaaacagcg
gaaaatttagttgaacaatatgaaattacaagagaggaacaagatgaagttgcgcttcgc
agtcatacattggcattgaaggcaatcgagtctggatattttgacgatcaaattgttcct
attacaataaaagaacgtagaaaagaagtagtattttcgaaggatgaacatccacgtgct
gacattacagcagaaaaattagcaggattaaaaccagctttccgtaaaggcggatctgta
acggcagggaatgcatctggcctgaatgacggaagcgcggttctagtattaatgagcgaa
gaaaaagcgaaagaaaaaggcttacaaccgttagctagaattgttggatattcagtagct
ggagtagatccaaaaattatggggattggaccagcaccagcaattcgtaaaggattagaa
aaagtagattggtcattagaagatgcagatttactggaaattaatgaagctttcgctgcg
caatacttagctgtagagaaagaactaggtttagatcgtgaaaaagtgaatgtaaacggt
agtggtgtaggacttggacatccaatcggttgtacaggagctcgtattactgtaagttta
attcatgaattgaagagacgcgggttagaaaaaggaattgcctctctatgcgtcggcggc
ggtattggggtagcattatttatagaagcactataa

DBGET integrated database retrieval system