KEGG   Bacillus thuringiensis serovar finitimus YBT-020: YBT020_21460Help
Entry
YBT020_21460      CDS       T01839                                 

Definition
(GenBank) phenylalanine 4-monooxygenase
  KO
K00500  phenylalanine-4-hydroxylase [EC:1.14.16.1]
Organism
btf  Bacillus thuringiensis serovar finitimus YBT-020
Pathway
btf00360  Phenylalanine metabolism
btf00400  Phenylalanine, tyrosine and tryptophan biosynthesis
btf00790  Folate biosynthesis
btf01100  Metabolic pathways
btf01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:btf00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    YBT020_21460
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    YBT020_21460
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    YBT020_21460
Enzymes [BR:btf01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.16  With reduced pteridine as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.16.1  phenylalanine 4-monooxygenase
     YBT020_21460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Biopterin_H
Motif
Other DBs
NCBI-ProteinID: ADY23520
UniProt: F0PY24
Position
4177395..4179149
Genome map
AA seq 584 aa AA seqDB search
MTKKTEIPSHLKPFVSTQHYDQYTPVNHAVWRYIMRQNHSFLKDVAHPAYVNGLQSSGIN
IDAIPKVEEMNECLAPSGWGAVTIDGLIPGVAFFDFQGHGLLPIATDIRKVENIEYTPAP
DIVHEAAGHAPILLDPTYAKYVKRFGQIGAKAFSTKEEHDAFEAVRTLTIVKESPTSTPD
EVTAAENNVLEKQKLVSGLSEAEQISRLFWWTVEYGLIGNIDAPKIYGAGLLSSVGESKY
CLTDAVEKVPFSIEACTSTTYDVTKMQPQLFVCESFEELTEALEKFSETMAFKTGGKEGL
EKAIRSENHATAELNSGLQITGTFTETIENDAGELIYMRTSSPTALAIHNKQLANHSTSV
HSDGFGTPIGLLTENIALENCTDEQLQSLGITIGNVAEFTFASGIHVKGTVTDIVKNDKK
IALISFINCTVTYNDRVLFDASWGSFDMAVGSTITSVFPGAADAAAFFPMDEEIQEIPAP
LVLNELEHMYQTVRDIRNEGILHDAHIEQLIAIQEVLNKLYPKEWLLRLEILELLLEHNK
GHETSAALLQQLSTFTTDEAVTRLINNGLTLLPVKDVKNDATIN
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
atgacaaagaaaacagaaattccatcgcatttaaaaccattcgtatccacacagcattat
gatcaatacacaccggtgaatcacgctgtgtggcgttacattatgagacaaaatcatagt
ttcttaaaagacgttgctcatccagcctatgtgaacggattacaatcatctggtattaat
atagatgcaattccaaaggtagaagaaatgaatgagtgtttagcaccaagcggctggggt
gctgtaacgattgacgggcttattcctggcgtagccttcttcgattttcaaggacacgga
ttattaccaatcgcaacagatattcgcaaggtagagaatatcgagtatacaccagctcca
gatattgtacacgaagcagcaggacacgcacctattttacttgatcctacatatgcaaaa
tatgtgaaacgatttggacaaattggtgcaaaagctttctcaacaaaagaagaacatgat
gcattcgaagctgttcgtacattaacaattgtaaaagaaagccctacttctactcctgat
gaagttacagctgctgagaataatgtacttgaaaaacaaaagttagtttctggcttatca
gaagcggaacaaatttcacgtcttttctggtggacagtagaatatggattaattggaaat
atagatgctccaaaaatatatggtgctggtctcctttcttctgttggcgaaagcaaatat
tgcttaacagacgctgtagaaaaggttccattctctatagaggcatgtacaagtacaact
tatgacgtaacaaaaatgcaaccacaactatttgtttgtgaatcatttgaagaattaaca
gaagcacttgagaaattctctgaaacgatggcctttaaaacaggtggtaaagaaggatta
gaaaaagcaattcgctctgaaaatcatgcaactgctgaattaaatagcggcttacaaatt
acaggtacatttaccgagacaattgaaaacgatgcaggtgaattgatttatatgcgaacg
agctcgccaacagcattagcaattcacaataaacagctagcgaatcattctacgtctgta
cacagtgacgggtttggaacaccaattggattactcactgaaaatattgcattagaaaat
tgtacagatgaacaattacaatcattaggaattacaattggaaatgttgctgagtttact
tttgcaagtggtattcatgtaaaaggaacagtaacagatattgtaaaaaacgataaaaaa
attgcgcttatttcctttatcaattgcacagttacttataacgaccgcgttttatttgat
gcttcatggggctcatttgatatggctgttggttcaacaattacttcggtattcccaggt
gccgcagatgctgcagcatttttcccaatggatgaagaaatccaagaaatacctgctcca
cttgtactgaatgaacttgaacatatgtatcaaaccgttcgtgacattcgaaatgaaggt
attttacacgacgcgcatatcgagcaattaatagcaattcaagaagtattaaataaattg
tatccgaaagaatggttacttcgccttgaaatattagaattgcttttagaacataacaaa
gggcatgaaacatcagcagcattattacaacaactttctactttcacaacggatgaagct
gtaacacgtcttattaacaatggtcttacgctacttccagtaaaggatgtgaaaaatgat
gctacgattaactga

DBGET integrated database retrieval system