KEGG   Bacillus thuringiensis serovar finitimus YBT-020: YBT020_26730Help
Entry
YBT020_26730      CDS       T01839                                 

Definition
(GenBank) aminopeptidase
  KO
K19701  aminopeptidase YwaD [EC:3.4.11.6 3.4.11.10]
Organism
btf  Bacillus thuringiensis serovar finitimus YBT-020
Brite
KEGG Orthology (KO) [BR:btf00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:btf01002]
    YBT020_26730
Enzymes [BR:btf01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.6  aminopeptidase B
     YBT020_26730
    3.4.11.10  bacterial leucyl aminopeptidase
     YBT020_26730
Peptidases and inhibitors [BR:btf01002]
 Metallo peptidases
  Family M28: aminopeptidase Y family
   YBT020_26730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M28 PA Peptidase_M20 Peptidase_M42
Motif
Other DBs
NCBI-ProteinID: ADY24568
UniProt: F0PVA7
Position
5216677..5218077
Genome map
AA seq 466 aa AA seqDB search
MKKSLKQKIVTSLLAVSLAVSIAPVGQAKADSTSEITQTSPITKQVDASRAIEHIRFLSE
TIGPRPGGTKSEEWASRYVGMQLKSMGYEVEYQPFQVPDQYVGFIESPLSTKRNWQAGAA
PNALISTEAVTAPLIFVQGGTKLEDIPNEVNGKIVLFERGTTVADYNKQVENAVSKGAKG
VLLYSLIGGRGNYGQTFNPRLTKKQSIPVFGLAYAQGNAFKEEIAKKGTTILSLKARHES
NLTSLNVIAKKKPKNSTGNEKAVVVSSHYDSVVGAPGANDNASGTGLVLELARAFQNVET
DKEIRFIAFGSEETGLLGSDHYVNSLSQKERDRILGVFNADMVATNYDKAKNLYAMTPNG
SPNLVTDAALQAGKQLNNDLVLQGKFGSSDHVPFAEVGIPAALFIWMGVDSWNPLIYHIE
KVYHTPQDNVFENISPERMKMALEVIGTGVYNTLQKPVAQTEQKAA
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaatctttgaaacaaaaaatagtaacctctttgcttgctgtatcactcgctgtt
agcatagctccagtcggacaagccaaagctgattccacgtcagaaatcacacaaacttca
cctatcacaaaacaagttgatgcaagccgcgctatcgaacacatccgtttcttatccgaa
acaattggtcctcgccctggtggaacaaaatcagaagaatgggcttctcgctacgttggt
atgcagcttaaatcaatgggctatgaagtagaatatcaaccattccaagtgccggatcaa
tacgttggatttattgaatcaccattatccacaaagcgtaattggcaagctggtgctgct
cctaacgcactaatttctacagaggctgttacggctcctcttatctttgttcaaggtggg
acaaaattagaggatatcccaaatgaagtaaatggaaaaattgttctattcgaaagagga
acaacagtagctgactataataaacaagttgaaaatgccgttagcaaaggagcaaaaggt
gttcttttatacagtttaattggtggacgtggaaactacggacaaactttcaatccccgc
ctaacgaaaaagcaatctatccctgtctttggtcttgcttatgcgcaaggaaatgcattt
aaagaagaaatcgctaaaaaagggacaacaattctttccctaaaagcgagacatgaatct
aatttaacgtcattaaacgtcattgctaaaaagaagccaaaaaatagtacaggtaatgaa
aaagctgtcgttgtaagttcacactacgatagtgtcgttggagcacctggagcaaatgac
aatgcttctggtacagggttagtattagagttagcacgcgcttttcaaaatgtagaaact
gataaagaaattcgttttattgctttcggttctgaagagactggcctacttggttccgat
cattacgttaatagtctatcccaaaaagaacgtgaccggattttaggtgtctttaacgca
gacatggttgcaacaaattacgataaggcgaagaatttatatgctatgacgcctaacggt
tctccaaatcttgtaacagacgcagccttacaagcaggtaaacaattaaataatgacctc
gttctgcaagggaaatttggctctagtgatcacgtaccgtttgctgaagttggtattcct
gcggctctatttatctggatgggtgtcgatagttggaatccattaatctaccatatcgaa
aaggtatatcacacacctcaagataacgtatttgagaatatttcacctgaacgtatgaaa
atggcattagaggttattggaacaggagtttataatacacttcaaaaacctgtcgctcaa
actgaacaaaaagctgcttag

DBGET integrated database retrieval system