KEGG   Bacillus thuringiensis Bt407: BTB_c12860Help
Entry
BTB_c12860        CDS       T02277                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerol phosphate synthase TrpC
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
btg  Bacillus thuringiensis Bt407
Pathway
btg00400  Phenylalanine, tyrosine and tryptophan biosynthesis
btg01100  Metabolic pathways
btg01110  Biosynthesis of secondary metabolites
btg01130  Biosynthesis of antibiotics
btg01230  Biosynthesis of amino acids
Module
btg_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:btg00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BTB_c12860 (trpC)
Enzymes [BR:btg01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     BTB_c12860 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS NanE FMN_dh His_biosynth
Motif
Other DBs
NCBI-ProteinID: AFV16981
Position
1250758..1251519
Genome map
AA seq 253 aa AA seqDB search
MGTILDKIVEQKKKEVAELYEIYTPVKTKRKTHSLVEALQQFTVIAEVKRASPSKGDINL
HVDVRKQVGTYEKCGAGAVSVLTDGQFFKGSFHDLQTAREESNIPLLCKDFIIDKIQIDR
AYEAGADIILLIVAALTKEKLKELYSYVLEKGLEAIVEVHDEQELETAIVLNPHVIGINN
RNLKTFEVDLSQTEKLGKRLNEEKLLWISESGIHSKEDIIRVKRAGAKGVLVGEALMTSS
SISSFFEDCKVNI
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
gtggggacgattttagataaaattgtagaacagaagaaaaaggaagttgcggagttatat
gaaatatatacaccagtaaaaacaaaaagaaagacacattcacttgtagaagcgttacag
cagtttactgtcattgcagaagtaaagcgagcatcaccatcaaaaggagatatcaattta
cacgttgacgtacgaaaacaagtgggaacatatgagaaatgtggtgcaggagcagtatct
gttttaacagatggtcaattttttaaaggatcgtttcacgatttacaaacagcaagagaa
gaaagtaacattccgcttttatgtaaagatttcataatcgataagattcaaatcgataga
gcgtatgaagcgggagcagatattattttactaatcgtagcagcgttaacgaaagagaag
ttaaaagagctgtatagctacgtgttagaaaaaggattagaagcgattgttgaagttcat
gatgaacaggaattagaaactgcgattgtattaaatccgcacgttattggcattaataat
cgtaatttaaaaacgttcgaagtagatttaagccaaactgaaaagcttggaaaaagattg
aatgaggagaaactactttggattagtgaaagtggcattcattcaaaagaagatattatt
cgtgttaaaagagctggagccaaaggtgtattagttggagaggcgcttatgacatcatct
tctattagtagtttttttgaagattgtaaggtgaatatatga

DBGET integrated database retrieval system