KEGG   Bacillus thuringiensis Bt407: BTB_c26650Help
Entry
BTB_c26650        CDS       T02277                                 

Gene name
tenA2
Definition
(GenBank) thiaminase-2
  KO
K03707  thiaminase (transcriptional activator TenA) [EC:3.5.99.2]
Organism
btg  Bacillus thuringiensis Bt407
Pathway
btg00730  Thiamine metabolism
btg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:btg00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    BTB_c26650 (tenA2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:btg03000]
    BTB_c26650 (tenA2)
Enzymes [BR:btg01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.99  In other compounds
    3.5.99.2  aminopyrimidine aminohydrolase
     BTB_c26650 (tenA2)
Transcription factors [BR:btg03000]
 Prokaryotic type
  Other transcription factors
   Others
    BTB_c26650 (tenA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TENA_THI-4 TPR_MLP1_2 Paramyxo_C
Motif
Other DBs
NCBI-ProteinID: AFV18349
Position
2602330..2603019
Genome map
AA seq 229 aa AA seqDB search
MTFSQSLRKEVDSIWEASFNHPFVKKLGEGTLDLASFRYYVLQDSYYLSHFARVQTLGAA
KALELETTARMAHHAQNTYEAELSLHENFAKKLGITKEEKDNFIPAPTAYAYTSHMYRAA
YEGHLGDIIAAILPCYWLYYEIGEHLKECQPEEPIYNEWISAYGSDWFRTLVEEQITRLD
TIAENVTEADRKRMKQHFIISSQYEYSFWEMAYTLEKWPVDKDVKDVIG
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgactttttcacaatcattacgtaaagaagtagattcaatttgggaagcgagttttaac
catccttttgtaaaaaaacttggtgaaggaacattagatttagctagttttcgctattat
gtgcttcaagattcatattatttgagtcattttgctagagtacaaactttaggagctgca
aaagctcttgaattagagacgacagctcgtatggcacatcatgctcaaaatacatatgag
gccgagttatctttacatgagaattttgctaaaaagctagggataacaaaagaagaaaaa
gataattttattcctgcgccaactgcatatgcgtatacttcacatatgtatcgtgctgcg
tatgaagggcatttaggagatatcattgcagcaattttaccttgctattggttgtattat
gaaattggcgaacacttaaaagagtgccagccggaagagccaatttataacgaatggatt
tctgcttatggatctgattggttccgtacgctagttgaagaacaaattacacgtttagat
actatcgctgaaaatgtaacagaggcagaccgcaaacgtatgaaacagcattttattatt
agcagtcaatatgaatattcattttgggaaatggcttatacattagaaaagtggccagtg
gataaagacgtaaaagacgtaattggataa

DBGET integrated database retrieval system