KEGG   Bacillus thuringiensis Bt407: BTB_c34350Help
Entry
BTB_c34350        CDS       T02277                                 

Gene name
yqeC2
Definition
(GenBank) putative 6-phosphogluconate dehydrogenase YqeC
  KO
K00033  6-phosphogluconate dehydrogenase [EC:1.1.1.44 1.1.1.343]
Organism
btg  Bacillus thuringiensis Bt407
Pathway
btg00030  Pentose phosphate pathway
btg00480  Glutathione metabolism
btg01100  Metabolic pathways
btg01110  Biosynthesis of secondary metabolites
btg01120  Microbial metabolism in diverse environments
btg01130  Biosynthesis of antibiotics
btg01200  Carbon metabolism
Module
btg_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
btg_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:btg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BTB_c34350 (yqeC2)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BTB_c34350 (yqeC2)
Enzymes [BR:btg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.44  phosphogluconate dehydrogenase (NADP+-dependent, decarboxylating)
     BTB_c34350 (yqeC2)
    1.1.1.343  phosphogluconate dehydrogenase (NAD+-dependent, decarboxylating)
     BTB_c34350 (yqeC2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_binding_2 6PGD F420_oxidored NAD_Gly3P_dh_N Rossmann-like NAD_binding_11 GFO_IDH_MocA IlvN TrkA_N 2-Hacid_dh_C 3HCDH_N UDPG_MGDP_dh_N DUF3842 PDH
Motif
Other DBs
NCBI-ProteinID: AFV19117
Position
complement(3325074..3325967)
Genome map
AA seq 297 aa AA seqDB search
MQVGLIGLGKMGLNLGKNLMDHKHEVAAFDLNSSAVEEMKEYGATGVSSLNELVQSLQSP
RILWVMVPHAVVDSVIDEVTPLLSKGDILIEAGNSHYKESIRRYEQLKKDGIHFMDAGTS
GGMEGARNGACYMIGGDQEAWDIVEPIFRDTAVENGFLYAGKAGSGHFLKMVHNGIEYGM
MAAIGEGFEILEKSEFDYDYEKVSRVWNNGSVIRSWLMELTENAFSKDAKLDEIKGVMHS
SGEGKWTVETALDLQTATPVIAMSLLMRYRSLDNDTFTGKVVAALRNEFGGHAVEKK
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgcaagtaggattaattggtttaggtaaaatgggattaaacttagggaaaaatttaatg
gatcataaacatgaagtagcagcatttgatttaaattcaagtgcagtagaagaaatgaaa
gaatacggggctacaggtgtatctagcttaaatgaacttgttcagtcattacaatcacca
agaattctttgggtaatggtaccacacgctgttgttgattctgttattgatgaggttaca
ccacttttatcaaaaggagatattttaattgaagctggtaattcacattataaagagtct
atccgccgatatgagcaattaaagaaagatggcattcactttatggatgcagggacttct
ggcggaatggaaggcgctcgtaatggtgcttgttacatgatcggaggagatcaagaagct
tgggacatcgttgaacctatcttccgcgatactgctgtagaaaatggattcttatatgca
ggaaaagctggtagtggtcacttcttaaaaatggttcacaacggaattgaatacggtatg
atggctgctattggtgaaggatttgagattctagagaaaagtgaatttgactacgattat
gaaaaagtatcaagagtatggaacaacggttcagtcattcgttcttggttaatggaatta
acagaaaatgcattttctaaagatgcaaaactggatgaaattaagggtgttatgcattct
tctggtgaaggaaaatggacagtagaaacagcattagaccttcaaacagcaactcctgtt
atcgcaatgtctctattaatgcgctaccgctcattagacaatgatacatttacaggaaaa
gttgtagcagctctgcgcaatgaatttggcggacatgcagtagaaaagaaataa

DBGET integrated database retrieval system