KEGG   Bacillus thuringiensis Bt407: BTB_c43980Help
Entry
BTB_c43980        CDS       T02277                                 

Gene name
yitJ
Definition
(GenBank) bifunctional homocysteine S-methyltransferase/5,10-methylenetetrahydrofolate reductase YitJ
  KO
K00297  methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
K00547  homocysteine S-methyltransferase [EC:2.1.1.10]
Organism
btg  Bacillus thuringiensis Bt407
Pathway
btg00270  Cysteine and methionine metabolism
btg00670  One carbon pool by folate
btg01100  Metabolic pathways
btg01110  Biosynthesis of secondary metabolites
btg01120  Microbial metabolism in diverse environments
btg01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:btg00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    BTB_c43980 (yitJ)
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    BTB_c43980 (yitJ)
Enzymes [BR:btg01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     BTB_c43980 (yitJ)
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.10  homocysteine S-methyltransferase
     BTB_c43980 (yitJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: S-methyl_trans MTHFR POR
Motif
Other DBs
NCBI-ProteinID: AFV20080
Position
complement(4260407..4262239)
Genome map
AA seq 610 aa AA seqDB search
MKLLDLLSKGIVIGDGAVGTLLHSHGLQSSFEELNVSDPDLIISIHKQYVAAGADVIQTN
TYGANEAKLRMYGLENQVTEINRAAVKLAKASVTDKNAILGTIGGMKHIGAVTTTDMERE
FMLLEQAGALLEEQVDGLLLETFYDEFELLHAVKVLRKQTNIPIVAQLALHEAGTTQNGN
DVNEILKQLIDYGANVVGLNCQLGPLHMTEAFKMISIPQNGYLSAYPNAGLPNYVEGRYV
YEGSPAYFEAMTPRFIEQGIRLLGGCCGTTPEHIQSMKHAVANVTPVIEKDTIQRPKVVH
THEKRSKAHVTLAEKAKKQTTVVVELDPPKTLDTQRFFEGARALKRAGADAITLADNSLA
SPRISNMAMGALLTKHDIPVLTHLTCRDHNVIGLQSHLLGLSALGMEEVLALTGDPARVG
DFPGATSVYDLSSIELIKMIKEMNDGRSILGKSIGPATRFSVGGAFNPHVRHLKAAVKRM
ERKIDAGAEYFLTQPIYDIALIEEVYEATKHLEQPIFIGIMPLVSKRNADFLHFEVPGIT
LPEEIRERMDGHETKEAAIEEGIRISQELIDAAMKYFNGIYLITPFLKYEITEHLVKYVR
EKQEVKEGIN
NT seq 1833 nt NT seq  +upstreamnt  +downstreamnt
gtgaaattactagatttattatcaaaaggaattgtaataggtgatggtgcggttgggacg
ttattgcattcacatggcttgcaaagtagctttgaagaattgaatgtatctgatccagac
ttaattatatcgattcataaacaatatgtagctgctggagcagatgtaattcaaacgaat
acgtatggagcaaatgaggcgaaattacgtatgtacggcttagaaaatcaagttacagaa
attaatagagcggcagtaaaactggcgaaagcatctgttacagataaaaatgcaatttta
ggaacaattggtggtatgaaacatatcggagccgttacaacgactgatatggaaagggag
tttatgctacttgaacaggcaggggctttactagaagaacaggttgatggattactatta
gaaactttttacgatgaatttgaattacttcatgctgttaaagtattacgtaagcaaacg
aacattccaattgttgctcaattagcgttacatgaagcaggtacgactcaaaatggaaat
gatgtcaatgaaatattaaagcaacttatagattacggtgcaaatgttgttggattaaat
tgtcaactagggccgcttcatatgacggaggctttcaaaatgatatcgattccgcaaaat
ggctatttatcagcatacccaaatgcaggtctcccgaattatgtggagggacgttacgta
tatgagggaagcccagcttattttgaggcgatgacgccgagatttattgagcaaggtatt
cggttattaggtggttgttgtggtacgactccagaacatattcaaagtatgaagcacgct
gttgcgaatgttacacctgtaatagaaaaagacaccattcaaaggccgaaagttgttcat
acgcatgagaaacgttcgaaggctcacgtcactctagcagagaaagcgaaaaaacaaacg
acagttgtagtggaattagatccaccgaaaacgttagatacacagcggttttttgaagga
gcaagagctttaaaaagagcgggagcagatgctattactctagcagataattcattagca
tcgcctcgtatttctaatatggcaatgggtgcgttattaacgaagcatgatatcccggta
ttgacacatttaacgtgtagggatcataacgtcattggactacaatctcatttgttaggt
ttatcggcgttagggatggaagaagtgttagctttaactggtgatccagcgcgcgttggt
gattttcctggtgcaacttctgtatacgatttgtcctctattgagctcattaaaatgatt
aaagaaatgaacgatggacgttcaattttagggaaatcaattggaccggcgacaaggttt
tctgtaggcggcgcatttaatcctcacgtgaggcacttaaaagcagcggttaagcgaatg
gaacgaaaaatagatgctggagcggaatattttttaactcagccaatttacgatatcgcg
ttaattgaagaagtgtatgaagcgacaaagcatttggaacaacctatttttattggaatt
atgccgttagtaagtaagcggaatgcagattttcttcattttgaggtaccgggtattact
cttccagaagaaataagagagagaatggatggacacgaaacgaaagaggcggcaattgag
gaagggattcgcatttcgcaagaattgatcgacgcagcgatgaaatattttaatggtatt
tatcttattacaccatttttaaaatatgaaattacagaacatcttgttaaatatgtaaga
gaaaagcaagaagtgaaagaaggtattaattga

DBGET integrated database retrieval system