KEGG   Bacillus thuringiensis Bt407: BTB_c44040Help
Entry
BTB_c44040        CDS       T02277                                 

Definition
(GenBank) metallo-beta-lactamase
Organism
btg  Bacillus thuringiensis Bt407
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lactamase_B Lactamase_B_2 Lactamase_B_3 Lactamase_B_6
Motif
Other DBs
NCBI-ProteinID: AFV20086
Position
complement(4267765..4268394)
Genome map
AA seq 209 aa AA seqDB search
MKWIQMPLGPLQTNAYILMNDQKECIIFDPGHEGEKLVTYLQEEQLKPLAVLLTHAHFDH
IGAVDAVRDAFHIPVYVHKEEADWLGDATVNGSQIFMMNRSITAKPADHIIDAEGTLTIG
SFNFEIFETPGHSPGSISYYSKEANAVFSGDVLFQMSIGRTDLPGGSFAELIGSIEEKLF
VLPDETAVLCGHGPETSIGFEKENNPFVQ
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgaaatggatacaaatgccgttaggcccattacaaacaaatgcttatattttaatgaac
gatcaaaaagagtgcattatctttgaccctggtcacgaaggtgaaaagctcgttacatat
ttacaagaagaacaattaaaaccattggctgttttattaacgcatgctcactttgatcat
atcggtgctgttgatgcggtaagagacgcttttcatattcctgtatacgtacataaagaa
gaagcagattggttaggagatgcaactgtaaacggctctcaaatttttatgatgaaccgc
agtattacagcaaaaccagcggatcatattattgatgcagaaggtacattaacaattgga
tcatttaattttgaaatttttgagacgccaggacattctccaggaagtatttcttattat
agtaaagaggcaaatgctgtattctcaggagatgtattgttccaaatgagcattggaaga
acagatttgcctggtggaagttttgctgaattaattggaagtattgaagagaaattattt
gtattaccagatgagacagcagtgttatgtggacatggtccagaaacaagcattggtttt
gaaaaagaaaataatccgtttgtacaataa

DBGET integrated database retrieval system