KEGG   Bacillus thuringiensis Bt407: BTB_c44050Help
Entry
BTB_c44050        CDS       T02277                                 

Definition
(GenBank) hypothetical protein
Organism
btg  Bacillus thuringiensis Bt407
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2759 DUF1761 Tetraspannin
Motif
Other DBs
NCBI-ProteinID: AFV20087
Position
4268466..4268738
Genome map
AA seq 90 aa AA seqDB search
MLSRQSFLKHVQYKRVNIPKTHNKKWVDRGGYCMGLVIIFTLVTLLAVFATLRTLREKNF
FASGFAIATVLVFGWFTIMTVLYNGYPPAA
NT seq 273 nt NT seq  +upstreamnt  +downstreamnt
atgctatctcgacaatcatttttaaaacatgtacaatataaaagagtaaatattccaaaa
actcataataagaaatgggtagacagaggaggatattgcatgggccttgttattattttt
acacttgtcactctgttagctgtatttgctacgcttagaacacttcgtgaaaaaaacttt
ttcgcgagcggctttgcaattgcaactgtactcgttttcggatggtttacgatcatgact
gttctatataacgggtatccaccagcagcttaa

DBGET integrated database retrieval system