KEGG   Bacillus thuringiensis Bt407: BTB_c44150Help
Entry
BTB_c44150        CDS       T02277                                 

Gene name
pstS2
Definition
(GenBank) phosphate-binding protein PstS
  KO
K02040  phosphate transport system substrate-binding protein
Organism
btg  Bacillus thuringiensis Bt407
Pathway
btg02010  ABC transporters
btg02020  Two-component system
Module
btg_M00222  Phosphate transport system
Brite
KEGG Orthology (KO) [BR:btg00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BTB_c44150 (pstS2)
  09132 Signal transduction
   02020 Two-component system
    BTB_c44150 (pstS2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:btg02000]
    BTB_c44150 (pstS2)
Transporters [BR:btg02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Phosphate transporter [MD:M00222] [OT]
    BTB_c44150 (pstS2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PBP_like_2 PBP_like SBP_bac_1 SBP_bac_11 Glycos_transf_N
Motif
Other DBs
NCBI-ProteinID: AFV20097
Position
complement(4277358..4278275)
Genome map
AA seq 305 aa AA seqDB search
MKWMRTPIIIFVLSIWFLCFEMSTAFALNDMGEVRVDGSSTVFPIIEAVAEEYTKVHPDV
KISISVSGTGGGFNRFSKGEVDINNASRVMKQVEKNEMKKNSIQFTPFEVANDGLTIVVN
RHNTWVDDMSVDELRLLWSEDGREKRWSQIHSTWPREQVKFYAPGVDSGTYDYFQNVILQ
NHRIVKKVSLSEDDQVIMQGVMNDKHAIAFVGYAYYMANRDKVKAIKVNGVFPTKETIQS
GKYKPLSRPLLTYVNNASIRNKMNVANYVEFMIQHVGNLAEEVGYVKLRKEKYNEQLRML
TEIIR
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
gtgaaatggatgcgtacaccgattataattttcgtactatcgatatggttcctctgtttt
gaaatgtctactgcatttgctttaaatgatatgggagaagtgagagttgatggatcctca
acggtttttcctattatagaagcagtagcggaggaatatacaaaggtgcatccagacgtg
aaaatttccatcagtgtttctggaactggaggaggatttaatcgtttcagtaaaggagaa
gtagatataaataatgcttcgagagtaatgaaacaagtcgagaaaaatgagatgaagaaa
aactctattcagttcacaccttttgaggtcgctaacgatggtcttacaattgttgtgaat
cggcacaatacatgggtagacgatatgtcagtagacgagttacgtttactgtggagtgaa
gatggaagagagaagcgatggtcacaaattcattcaacatggccacgtgaacaagtgaag
ttttatgcaccaggcgtagactctggtacttatgattattttcaaaatgtcatcttacaa
aatcatcgcattgtaaaaaaagtctctttgtctgaagatgatcaagttattatgcaaggg
gtaatgaatgataaacatgccattgcttttgtaggatatgcttattatatggctaatcga
gataaggtgaaagcaataaaagtgaatggtgtatttccgacgaaagagaccattcagtca
gggaagtataagccgttatctaggccgctacttacttatgtgaataatgcatctatccga
aataaaatgaatgtagcaaactatgttgagtttatgattcagcatgttggtaacctcgct
gaagaggtcgggtatgtaaaattacgaaaagaaaaatacaatgaacagctgcgtatgtta
acagaaataataaggtaa

DBGET integrated database retrieval system