KEGG   Bacillus thuringiensis Bt407: BTB_c44210Help
Entry
BTB_c44210        CDS       T02277                                 

Gene name
yqfZ
Definition
(GenBank) YqfZ
Organism
btg  Bacillus thuringiensis Bt407
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MAS20 DUF4065 O-antigen_lig Mlo U3_snoRNA_assoc
Motif
Other DBs
NCBI-ProteinID: AFV20102
Position
4284213..4284578
Genome map
AA seq 121 aa AA seqDB search
MKRLGIFLFVLVLGYIFYYDIKIGTLPMLSSYKKTTAAQTIKKENTDSQQNKENKTEKET
DTSYKTIEVKTGETVLSITEQINKKKIPSIEKVIDDFKQLNKSTSATKIQIGKSYKFPLY
Q
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
atgaagaggttaggtatattcctattcgtgcttgttctcggttatatattttattacgat
ataaaaatcggtactttaccgatgttaagttcatataaaaaaacaactgctgcccaaacg
ataaaaaaagaaaacacagacagccaacaaaataaagagaataaaacagaaaaagaaacg
gatacatcttataaaacaattgaagtaaaaactggcgagacagttctttctattacagaa
caaattaacaagaaaaaaattccttccatagaaaaagtcattgacgactttaaacaatta
aacaaaagtacatctgctacaaaaatacaaattggaaagtcttataaattcccgttatat
caataa

DBGET integrated database retrieval system