KEGG   Bacillus thuringiensis Bt407: BTB_c44230Help
Entry
BTB_c44230        CDS       T02277                                 

Gene name
zur
Definition
(GenBank) zinc-specific metallo-regulatory protein Zur
  KO
K02076  Fur family transcriptional regulator, zinc uptake regulator
Organism
btg  Bacillus thuringiensis Bt407
Brite
KEGG Orthology (KO) [BR:btg00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:btg03000]
    BTB_c44230 (zur)
Transcription factors [BR:btg03000]
 Prokaryotic Type
  Helix-turn-helix
   Fur family
    BTB_c44230 (zur)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FUR CDKN3 DUF4054
Motif
Other DBs
NCBI-ProteinID: AFV20104
Position
complement(4285926..4286339)
Genome map
AA seq 137 aa AA seqDB search
MNLTEALRLMKEKGYKHTGKREEMLRLFAAHNRYLTAKDVLEHMKDDYPGLSFDTIYRNL
TVFAEIGVLEQTELNGEKHFRFTCSIMEHHHHFICLDCGGTKEITSCPMDFMNKDFTGYE
VTGHKFEIYGRCPKCAK
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atgaatctaacagaagctttacgcctaatgaaggaaaaaggatacaaacatactggaaaa
agagaagagatgctcagattatttgcagcacataatcgttatttaactgcgaaagacgtt
ttagagcatatgaaagacgattatccagggcttagttttgatacgatttatcgtaactta
acagtttttgctgagattggtgttttagaacaaacggaattaaatggtgaaaaacatttt
cgtttcacttgttctattatggaacatcatcatcattttatttgtttggattgtgggggg
acgaaagagattacttcctgcccaatggattttatgaataaagattttactggttatgaa
gtaacgggtcataagtttgaaatatatggtcgttgtccaaaatgtgcaaagtaa

DBGET integrated database retrieval system