KEGG   Bacillus thuringiensis Bt407: BTB_c44270Help
Entry
BTB_c44270        CDS       T02277                                 

Definition
(GenBank) hypothetical protein
Organism
btg  Bacillus thuringiensis Bt407
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2624 ATP-synt_G
Motif
Other DBs
NCBI-ProteinID: AFV20108
Position
4289164..4289418
Genome map
AA seq 84 aa AA seqDB search
MNLIKQIVNKKLNHISTKELLKYSKEYEVSITTAQADQIVLLMKGKNINIYDNNERLELL
KQIAKVTSPATAQQVNTLFQQLLK
NT seq 255 nt NT seq  +upstreamnt  +downstreamnt
atgaacctcattaaacaaattgttaataaaaaattaaatcatatttctacaaaagagtta
ttaaaatatagcaaagaatatgaagtttctattacgactgcacaagctgaccaaatcgtt
ttacttatgaaaggtaaaaatattaatatttacgataacaacgagcgactagagctctta
aaacagatcgcaaaagtaacttcccctgccactgcccaacaagtaaatacattatttcag
caattactaaaataa

DBGET integrated database retrieval system