KEGG   Bacillus thuringiensis Bt407: BTB_c44280Help
Entry
BTB_c44280        CDS       T02277                                 

Gene name
nfo
Definition
(GenBank) putative endonuclease 4
  KO
K01151  deoxyribonuclease IV [EC:3.1.21.2]
Organism
btg  Bacillus thuringiensis Bt407
Pathway
btg03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:btg00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    BTB_c44280 (nfo)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:btg03400]
    BTB_c44280 (nfo)
Enzymes [BR:btg01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.2  deoxyribonuclease IV
     BTB_c44280 (nfo)
DNA repair and recombination proteins [BR:btg03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    AP endonucleases
     BTB_c44280 (nfo)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AP_endonuc_2 DASH_Dad1
Motif
Other DBs
NCBI-ProteinID: AFV20109
Position
complement(4289437..4290333)
Genome map
AA seq 298 aa AA seqDB search
MLKIGSHVSMSGKNMLLAASEEAVSYGATTFMIYTGAPQNTRRKPIEELNIEAGRKHMEL
NGIEEIIVHAPYIINVGNTTKPETFQLGVDFLRMEIERTSALGVAKQIVLHPGAHVGAGA
DAGIQQIIKGLNEVLTPEQTVNIALETMAGKGTECGRSFEEIAKIIDGVKYNEKLSVCFD
TCHTHDAGYDIVNDFDGVLNEFDKIVGIDRLQVLHINDSKNVRGAGKDRHENIGFGHIGY
KALHHIVHHPQLMHVPKILETPYVGEDKKDKKPPYKLEIEMLKNGTFDEGLLEKIKAQ
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgttaaagattggatctcatgtttccatgagtggtaagaacatgttattagcagcaagt
gaagaggctgtttcatacggtgcaacaacgtttatgatttatacaggtgcaccgcaaaat
acacgaagaaaaccaattgaagaattgaacatagaagcaggaagaaaacatatggagctg
aatggtattgaggaaattatcgtccatgcgccgtatattattaatgttgggaatacgacg
aagccagaaacattccaattaggtgtagacttccttcgtatggaaattgaaagaacatcg
gcattaggtgtagcgaaacaaattgttcttcacccaggagcgcacgttggtgctggagca
gatgctggtattcaacaaattattaaagggcttaatgaagtactaacgccagaacagacg
gttaacattgcgttagagacgatggcaggaaaaggaacagaatgtggtcgtagctttgaa
gaaattgcaaagatcattgatggcgtaaaatataatgaaaagctatctgtatgctttgat
acgtgtcatacgcacgatgcaggatatgatattgtaaatgactttgacggtgtattaaac
gaatttgataagatcgttggtatagatcgtttacaagtacttcatattaatgatagtaaa
aatgtacgcggagcaggaaaagaccgtcatgaaaacatcggatttggtcacattgggtat
aaagcgttgcatcacattgtacatcatccacagttaatgcatgtaccaaaaattcttgaa
acaccgtatgtaggggaagataaaaaagataagaagccaccatacaaattggaaatcgaa
atgctgaaaaacggtacttttgatgaagggcttcttgaaaaaattaaagcgcaataa

DBGET integrated database retrieval system