KEGG   Bacillus thuringiensis Bt407: BTB_c44360Help
Entry
BTB_c44360        CDS       T02277                                 

Gene name
dnaG
Definition
(GenBank) DNA primase DnaG
  KO
K02316  DNA primase [EC:2.7.7.-]
Organism
btg  Bacillus thuringiensis Bt407
Pathway
btg03030  DNA replication
Brite
KEGG Orthology (KO) [BR:btg00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    BTB_c44360 (dnaG)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:btg03032]
    BTB_c44360 (dnaG)
Enzymes [BR:btg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.-  
     BTB_c44360 (dnaG)
DNA replication proteins [BR:btg03032]
 Prokaryotic Type
  DNA Replication Initiation Factors
   Initiation factors (bacterial)
    BTB_c44360 (dnaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Toprim_N zf-CHC2 Toprim_2 Toprim_4 Toprim Toprim_3 DnaB_bind DUF4007 Condensin2nSMC PGM_PMM_I DnaB Rep_fac_C DUF3854
Motif
Other DBs
NCBI-ProteinID: AFV20117
Position
complement(4297740..4299536)
Genome map
AA seq 598 aa AA seqDB search
MGNRIPEEVVEQIRTSSDIVEVIGEYVQLRKQGRNYFGLCPFHGENSPSFSVSSDKQIFH
CFGCGEGGNVFSFLMKMEGLAFTEAVQKLGERNGIAVAEYTSGQGQQEDISDDTVIMQQA
HELLKKYYHHLLVNTEEGNEALSYLLNRGITKEMIEKFEIGYASPAWDAATKILQKRGLS
LSSMEQAGLLIRSEKDGSHYDRFRGRVMFPIYTLQGKVIAFSGRALGDDTPKYLNSPETP
IFHKSKLLYNFHQARPFIRKRGQVVLFEGYADVLAAVKSGVEEAVATMGTALTEEQAKLL
RRNVETVVLCYDGDKAGREATMKAGQLLLKVGCQVKVTSLPDKLDPDEYVQQYGTTAFEN
LVKSSVSFVGFKINYLRLGKNLQDESGKEEYVKSVLKELSLLQDAMQAESYLKSLSQEFS
YSMETLLNQLHQYRKEQKVQQKQIKQVAKPSQVVQTKPKLTGFERAEREIIYHMLQSAEV
AVRMESHIEDFHTEEHKGILYELYAYYEKGNEPSVGTFLSWLSDEKLKNIITDISTDEFI
NPEYTEEVLQGHLETLRRHQEKLEKMEIIFKVKQMEKTDPVEAAKYYVAYLQNQKARK
NT seq 1797 nt NT seq  +upstreamnt  +downstreamnt
atggggaacagaattcccgaagaagttgttgaacagattcggacatcatccgatattgta
gaagtcattggtgaatacgttcaacttagaaaacaggggcgtaactatttcggcctttgt
ccatttcatggtgagaattctccttcattctctgtttcatctgataagcaaatttttcat
tgcttcggatgtggagaaggtggaaatgtattttcctttctaatgaaaatggaaggactg
gcttttaccgaggctgttcaaaagctaggcgaaagaaatggaattgcggttgcagagtac
acatcaggacaaggacaacaagaagacatatctgatgacactgtcatcatgcaacaagct
catgaattattgaaaaagtattatcatcatttattagtaaatacggaagagggaaatgaa
gcactttcatatttattaaaccgtggtattacgaaagagatgattgagaagtttgaaatt
ggttatgcatcacctgcttgggatgcagcgacgaaaattttacaaaaaagaggtttatcg
ctgtctagtatggaacaagctggccttctaataagaagtgagaaggatggtagtcattac
gatcgcttccgtggaagagttatgttcccgatctatacgttacaaggtaaggtgatagcg
tttagtggaagggcgttaggggatgacactccgaaatatttaaatagccctgaaacaccg
atttttcacaaaagtaaattgttgtataacttccaccaagcaagaccgtttattagaaag
cgtgggcaagtggttctttttgaaggatatgccgatgtactagctgcggtaaaaagtggt
gtggaagaagctgttgcgacaatgggaacagctttaactgaagaacaagcaaaacttctg
cgacgtaacgttgaaactgttgttctttgctatgatggtgataaagcagggcgagaagcg
acgatgaaagcagggcaattattgctaaaagttggttgccaagtgaaagtcacatccttg
ccagataagcttgatcctgatgaatatgtgcaacaatatgggactaccgcttttgaaaat
cttgtgaaatcaagtgtgagttttgttggttttaaaataaattatttgcgtttagggaaa
aatttgcaagatgagtctggcaaagaagaatatgtgaaaagtgttttaaaagagttatcg
ttgttacaagatgcgatgcaggcagagtcatatttgaagtcattatcgcaagaattttcg
tattcaatggaaacacttttgaatcaattgcaccaatatcgcaaagaacaaaaggtacag
caaaaacaaataaagcaggttgctaaaccgtctcaagtcgttcaaacaaaaccgaagtta
acaggttttgaaagagcggaaagagaaattatttaccatatgttgcaaagtgcagaagta
gctgttcgtatggaatcccatatagaagattttcatacagaagaacataaagggatttta
tatgaactatacgcatattatgaaaagggaaatgaaccttcagtcggaacatttttaagt
tggctctctgatgaaaagttgaaaaatattatcactgatatttcgacggatgaatttatt
aatccagaatacacagaagaagtgttgcaaggccatttggagacgcttagacggcatcag
gaaaaacttgaaaagatggagatcatctttaaagtgaaacaaatggaaaaaacagatcct
gtagaggctgctaaatattatgtagcatatttacaaaatcaaaaagcgagaaaatag

DBGET integrated database retrieval system