KEGG   Bacillus thuringiensis Bt407: BTB_c44430Help
Entry
BTB_c44430        CDS       T02277                                 

Gene name
dgkA
Definition
(GenBank) diacylglycerol kinase DgkA
  KO
K00887  undecaprenol kinase [EC:2.7.1.66]
Organism
btg  Bacillus thuringiensis Bt407
Pathway
btg00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:btg00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BTB_c44430 (dgkA)
Enzymes [BR:btg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.66  undecaprenol kinase
     BTB_c44430 (dgkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAGK_prokar
Motif
Other DBs
NCBI-ProteinID: AFV20124
Position
complement(4304475..4304828)
Genome map
AA seq 117 aa AA seqDB search
MKKGKLIDSFGYAIAGIFFCFRHERNMKIHYLAAVIVICCGFYFHITKIEWMILLIVIGS
VMSLEMVNTAVEKTVDLATADIHPFAKIAKDVAAGAVLLFAIIAFIIGAIIFLPYMV
NT seq 354 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaggaaaacttatagatagttttggatatgctatagctggtatattcttttgt
tttcgtcatgaacgaaatatgaaaatccattatttagccgcagtcattgttatatgctgc
ggcttttatttccatattacgaaaatagagtggatgatattacttattgtaatagggagt
gtaatgagtttagagatggtaaatacggctgtggaaaaaacggtagatttagcgactgcc
gatattcatccgtttgcaaaaattgcaaaggatgttgcggcaggagcggttttattgttt
gcaattatagcttttataattggtgctattatctttttaccgtatatggtatag

DBGET integrated database retrieval system