KEGG   Bacillus thuringiensis Bt407: BTB_c44440Help
Entry
BTB_c44440        CDS       T02277                                 

Definition
(GenBank) putative rRNA maturation factor
  KO
K07042  probable rRNA maturation factor
Organism
btg  Bacillus thuringiensis Bt407
Brite
KEGG Orthology (KO) [BR:btg00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:btg03009]
    BTB_c44440
Ribosome biogenesis [BR:btg03009]
 Prokaryotic Type
  Other maturation factors
   BTB_c44440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UPF0054
Motif
Other DBs
NCBI-ProteinID: AFV20125
Position
complement(4304825..4305295)
Genome map
AA seq 156 aa AA seqDB search
MSLLIDFIDETEEVKEEYMSLIREVLEKAAQMENIEDGAEVSVTFVDNERIREINRDYRD
KDQPTDVISFAMEEMGEGEMEIVGAEMPRMLGDLIISIPRAKEQAEEYGHSFDRELGFLA
LHGFLHLLGYDHMTEEDENEMFGRQKEILEAFGLGR
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atgagtttgttaattgattttattgatgaaacagaagaagtaaaagaagagtatatgagt
ttaattcgtgaagtgttagaaaaagcagctcaaatggaaaatatcgaggatggtgcggag
gtatcggtgacatttgtagataatgagcgcattagagaaattaatcgtgattaccgagat
aaagatcaacctacagatgtaatatcctttgccatggaagagatgggagaaggagaaatg
gagattgttggtgcagagatgccgcgcatgttaggggatcttattatctctattccaagg
gcgaaagagcaagctgaagagtacggacattctttcgatcgtgaacttggatttttggcg
ttacatggctttttacatttacttggttatgatcacatgacagaagaagatgaaaatgaa
atgttcggaagacaaaaagaaattttagaagcttttggattaggacgatga

DBGET integrated database retrieval system