KEGG   Bacillus thuringiensis Bt407: BTB_c44450Help
Entry
BTB_c44450        CDS       T02277                                 

Definition
(GenBank) metal-dependent phosphohydrolase
  KO
K07037  uncharacterized protein
Organism
btg  Bacillus thuringiensis Bt407
Brite
KEGG Orthology (KO) [BR:btg00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    BTB_c44450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 7TM-7TMR_HD 7TMR-HDED HD Sfi1_C HD_5 YwiC
Motif
Other DBs
NCBI-ProteinID: AFV20126
Position
complement(4305292..4307436)
Genome map
AA seq 714 aa AA seqDB search
MSRSQEISKWFRNLQHSKKLSWISYVVLGAVLFFALMNNVKPEQLDVNMYSIAKKTIHSP
IKIEDKVTTDKKKKEAATKVEDQYTYKSEYKQNKVDIVNDVFAKVDEVVQEIKAVGPDDQ
KKMTDAEKVDKLKKKLPADLTKELSDSNLLNLINADSSQLVLAKDAAVTAINSIMTEHIK
MDELKDAKERYVSEMNSVNVDNGLKESIKALGRYAISANYFYDPILTKEKRKAEEDLVPP
VYILQGQVLVREGETISSDVYNQLKLVGLLEKGNGFQPYVGLAVLIGVLLYFMHKQFELF
LKRKREDRPYVLAYITILSITIVLMKIISLFQKLEYAGIAYVVPVAMGTILVKLMIGDRF
VFLTSMIFSVCGSIMFNEGVTSTLNYSVGIYVLLSSLSVSIFLREKNRRTMILQAGILVS
VLNVVVLAALLLLRNGNFSPLEIGTQLLMASLSGIISSVLAMGILPYLESGLGIVSSMKL
MELSSPNHPLLRRILLEAPGTYHHSVMVANLSEAACEAVGANGVLARVGAYYHDVGKTVQ
PQFFIENQMGIENPHDKLDPVTSKDIIIAHVTDGVRMLEEYHIPQEIIDIAGQHHGTTLL
KYFYYKAIKEDKEKYTEEMFRYPGSKATSKESAIVGIADSVEAAVRSMNHPTPEQINNLV
QSIIKDRLQDGQFSECDLTFKELQIVGKTLCETLNGIFHSRITYPEPPEEKEKE
NT seq 2145 nt NT seq  +upstreamnt  +downstreamnt
atgtcaagatctcaagaaatttctaagtggtttcgtaatttacaacattcgaaaaaacta
agttggatttcttacgttgtgttaggagcagtgctgttttttgcgcttatgaataatgta
aaaccagaacaattagatgttaatatgtattctattgcgaaaaagacaatccattctcct
ataaaaattgaagataaagttacaacggataaaaagaaaaaagaagccgctacaaaagtt
gaagatcaatatacatataaaagtgagtataaacaaaacaaagttgatattgtgaatgac
gtctttgctaaagtggatgaagtggtgcaagagattaaagctgttggaccggatgatcaa
aaaaagatgactgatgctgagaaagtggataagttaaaaaagaaactacccgctgactta
acgaaagaattatctgattcaaacttactaaatttgattaatgcagattcgagccaatta
gtattagcgaaagatgctgcggtcacagcgattaatagtatcatgactgagcatattaaa
atggacgaattgaaagatgcgaaagaacgatatgtaagtgagatgaatagtgttaatgtt
gataatggtttaaaagagtcaattaaggcgctaggaagatatgcaatttcagcgaactat
ttttatgacccgatcttaacgaaagagaagagaaaagcagaggaagatttagttccacct
gtttatattcttcaaggacaagttcttgttagagaaggtgaaacgatttcaagtgatgtg
tataatcagttgaaattagttggtttgttagaaaaagggaacggctttcaaccttatgtt
ggattagcggtactcattggtgtattactatactttatgcataaacaatttgaattattt
ttaaagagaaaaagagaagatagaccgtatgttttagcgtatattacaattttgtctatc
acaatcgtcttaatgaaaatcattagtttgtttcaaaaacttgaatacgcagggattgca
tatgttgtcccagttgcgatgggaacaatacttgtaaaactaatgattggtgatcgattt
gtctttttaacgagtatgattttttctgtatgcggaagtattatgtttaatgaaggagta
acgagtacattaaattatagtgtagggatttacgtattgttaagttcattatcggttagt
attttcttgcgagaaaaaaatcgtcgtacaatgattttacaagctggtatactcgtttct
gtattaaatgtagtcgtattagcggcgctcttattattacgtaatgggaatttttcgcct
cttgaaattggtacgcaattattaatggcttcactttcagggattatatcatccgttttg
gctatggggattttaccatatttagaaagtggacttggaatcgtatcaagtatgaagctt
atggaactatcaagtccaaatcatccgcttttacgcagaattttgttagaagcgccaggg
acatatcatcatagtgtaatggtagcgaatctttctgaggctgcttgtgaagcagttggg
gcaaatggtgtattagcgcgtgtaggggcatattatcatgatgtaggaaaaacagtacaa
ccgcaattctttattgaaaaccaaatgggaattgaaaatccgcatgataaattagatcct
gtaacgagtaaagatattataattgctcacgtaacggatggagtaagaatgctcgaagaa
tatcatattccacaagaaattattgatatcgctgggcaacatcacggtacaacgttactg
aaatatttttattataaagctattaaagaggataaagaaaaatatacagaagagatgttc
cgttatccaggttcaaaagcaacttcgaaagaatcggcaattgttggtattgctgatagt
gtagaagctgcggtacgttctatgaatcacccaacgccagaacaaattaataatttggtg
caaagtattattaaagatcgactgcaagacggtcaatttagtgaatgtgatttgacgttt
aaggaactacaaatcgttgggaaaacgttgtgtgaaacgttaaatggtattttccattcg
cgtattacatatccggaacctccggaagaaaaggagaaagaatga

DBGET integrated database retrieval system