KEGG   Bacillus thuringiensis Bt407: BTB_c44460Help
Entry
BTB_c44460        CDS       T02277                                 

Gene name
phoH
Definition
(GenBank) PhoH-like protein PhoH
  KO
K06217  phosphate starvation-inducible protein PhoH and related proteins
Organism
btg  Bacillus thuringiensis Bt407
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PhoH AAA_30 AAA_19 IstB_IS21 UvrD-helicase AAA_22 DEAD ResIII AAA_25
Motif
Other DBs
NCBI-ProteinID: AFV20127
Position
complement(4307631..4308590)
Genome map
AA seq 319 aa AA seqDB search
MAEQLVEMNQQLENTNEAIALFGVNDAHLKVIERELNVSIVTRGETVHVSGAVETVTLVE
KILQQLLVVIRKSISISERDVAYAIQLAQQGKIAQFEELYEEEIFKTAKGKSIRVKTMGQ
RRYIHAMKKNDIVFGIGPAGTGKTYLAVVMAVRALKQGYVKKIILTRPAVEAGENLGFLP
GDLKEKVDPYLRPLYDALHDILGQEYTQRMMERGVIEIAPLAYMRGRTLDDSFVILDEAQ
NTTGAQIKMFLTRLGFSSKMVITGDPSQVDLPKGVKSGLSIAANILSGVSGLSFITLEQT
DVVRHPLVQRIIEAYDKME
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atggcagaacaattagtagaaatgaaccaacaattggaaaatactaacgaagcaatcgct
ctttttggagtcaatgatgcacatttaaaagtaattgaacgagaactgaatgtatcgatc
gtaactagaggagaaactgttcatgtatctggagcagttgaaacggtgacactcgtagaa
aaaatcttacagcaattacttgttgtaattcgtaaaagtatatcaatttcagagagagat
gttgcgtatgcaattcagctcgcgcaacaagggaaaattgctcaatttgaagagttatat
gaagaagaaattttcaagactgcaaaaggtaaatccattcgtgtaaaaacaatggggcaa
agaagatatattcatgcgatgaagaagaatgatattgtctttgggatagggcctgcagga
actggaaaaacatacttagctgtagtaatggctgtgagagctttaaaacaaggatatgta
aagaaaattattttaacaagacctgctgtagaagctggagaaaatttaggttttttacca
ggggatttgaaagagaaggtagatccatacttacgtccattatatgatgccttacatgat
attcttggacaagaatatacgcagcgtatgatggagcgaggagtaattgaaatagctccg
cttgcttatatgagggggcgtacgcttgatgattcatttgttattttagatgaggctcaa
aatacaacgggtgctcaaataaaaatgtttttaacaagattaggttttagctctaaaatg
gttattacaggggacccttcacaagtagacttgccaaaaggggtaaaatcagggctatct
atagctgctaatattttatctggtgtatcaggtctgtcatttattacattagaacaaacg
gacgttgtgagacatccattggtgcaacgtattattgaggcatatgataaaatggaatga

DBGET integrated database retrieval system