KEGG   Bacillus thuringiensis Bt407: BTB_c44580Help
Entry
BTB_c44580        CDS       T02277                                 

Gene name
hrcA
Definition
(GenBank) heat-inducible transcription repressor HrcA
  KO
K03705  heat-inducible transcriptional repressor
Organism
btg  Bacillus thuringiensis Bt407
Brite
KEGG Orthology (KO) [BR:btg00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:btg03000]
    BTB_c44580 (hrcA)
Transcription factors [BR:btg03000]
 Prokaryotic Type
  Other transcription factors
   Others
    BTB_c44580 (hrcA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HrcA HrcA_DNA-bdg HTH_11 HTH_12 NLE HTH_DeoR Ribosomal_S19e
Motif
Other DBs
NCBI-ProteinID: AFV20139
Position
complement(4319473..4320489)
Genome map
AA seq 338 aa AA seqDB search
MLTERQLLILQTIIDDFIGSAQPVGSRTLAKKDEITFSSATIRNEMADLEELGFIEKTHS
SSGRVPSEKGYRFYVDHLLAPQNLPNAEIVQIKDLFAERIFEAEKIAQQSAQILSELTNY
TAIVLGPKLSTNKLKNVQIVPLDRQTAVAIIVTDTGHVQSKTITVPESVDLSDLEKMVNV
LNEKLSGVPMEELHNKIFKEIVTVLRGYVHNYDSAIKMLDGTFQVPLSEKIYFGGKANML
SQPEFHDIQKVRSLLTMIDNEAEFYDILRHKQVGIQVKIGRENTSTAMEDCSLISATYSI
GEEQLGTIAILGPTRMQYSRVISLLQLFTRQFTDGLKK
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgcttacggaacgtcagctcttaattttacaaacaattattgatgactttattggatca
gcgcagcctgttgggtctagaacgttggctaaaaaagatgaaatcacatttagttcagct
actattcgaaatgaaatggcggacttagaagaattaggttttattgaaaaaacgcacagt
tcttctggacgtgttccttctgagaaaggctaccgattttatgtagaccatcttttagcg
ccgcaaaacttaccgaacgctgaaattgtacaaattaaagatttatttgctgaaagaatt
tttgaagcggaaaaaattgcacagcaatctgctcaaattttatcagaacttacgaattat
acggccattgttcttggaccgaagttaagtacaaataaacttaaaaatgtacaaattgtg
ccgcttgatcgtcaaactgcagtcgctattattgtaactgatacagggcatgtacaaagt
aaaacgattaccgttccggaatctgttgatttatcagatttagaaaaaatggttaatgtt
ttaaatgaaaagctatctggcgtaccgatggaagaacttcataataaaatctttaaggaa
attgttacagttttacgtgggtatgttcataattacgatagtgcaataaaaatgttagat
ggtacatttcaagttccgttatcggaaaagatatactttggaggaaaagcaaatatgctt
tcgcagccagagttccatgacattcaaaaggttagatctttgcttaccatgattgataat
gaagccgaattttatgacattttgcgtcataaacaagtcgggattcaagtgaaaattggt
agggaaaacacttcgacggctatggaggattgcagtttaatttctgcaacatattcgatc
ggcgaagagcaacttggaacaattgctattttaggtcctacgagaatgcaatattctcgt
gtaattagtttgttacagttatttacgagacaatttactgatggacttaaaaagtaa

DBGET integrated database retrieval system