KEGG   Bacillus thuringiensis Bt407: BTB_c44610Help
Entry
BTB_c44610        CDS       T02277                                 

Gene name
lepA
Definition
(GenBank) elongation factor 4
  KO
K03596  GTP-binding protein LepA
Organism
btg  Bacillus thuringiensis Bt407
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU LepA_C EFG_C GTP_EFTU_D2 EFG_II MMR_HSR1 Ras RF3_C SRPRB PduV-EutP MMR_HSR1_Xtn RsgA_GTPase Roc
Motif
Other DBs
NCBI-ProteinID: AFV20142
Position
complement(4322319..4324142)
Genome map
AA seq 607 aa AA seqDB search
MNKEERAKRQSKIRNFSIIAHIDHGKSTLADRILEKTNALTQREMKAQLLDSMDLERERG
ITIKLNAVQLNYKAKDGEEYILHLIDTPGHVDFTYEVSRSLAACEGAILVVDAAQGIEAQ
TLANVYLALDNNLEILPVINKIDLPSADPERVRQEVEDVIGLDASEAVLASAKAGIGIEE
ILEQIVEKVPAPAGDSEEPLQCMIFDSLYDPYRGVIAYIRVVNGTVKVGDKVRMMATGKE
FEVTEVGVFTPKTTQRDELTVGDVGFLAASIKNVGDTRVGDTITHAKRPAAEALPGYRKL
NPMVFCGLYPIDSARYNDLRDALEKLELNDSALEFEPETSQALGFGFRCGFLGLLHMEII
QERIEREFKIDLITTAPSVIYKVYLTNGEDVIVDNPSNMPDPQSIDRVEEPFVKASIMVP
NDYVGAVMEICQGKRGTFIDMQYLDETRVTLTYEIPLSEIVYDFFDQLKSNTKGYASFDY
ELIGYKPSKLVKMDILLNNEQVDALSFIVHRDSAYDRGKVIVEKLKELIPRQQFEVPIQA
TIGNKVVARSTIKAMRKNVLAKCYGGDISRKRKLLDKQKEGKKRMKSVGSVEVPQEAFMA
VLKMDDN
NT seq 1824 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaagaagaaagagcaaaaagacagtccaaaattcgtaatttctctattattgct
catattgaccacggaaaatcaacgttagcagaccgtattttagagaaaacaaatgcgtta
acacaacgcgaaatgaaagctcagttgcttgactctatggatttagagcgtgagcgtggt
attacaatcaaattaaacgcagttcaattaaactataaagcaaaagatggtgaagaatat
attcttcatttaattgatacaccaggacacgtcgactttacgtacgaagtatctcgtagt
ttagcggcttgtgaaggcgcgattcttgtagtagatgcagcgcaaggtattgaagctcaa
acgttagcgaacgtatacttagcgctcgataacaacttagaaattttaccagttatcaat
aaaatcgacttaccaagtgcggatccagaacgtgtacgtcaagaggtagaagatgtaatt
ggtttagatgcatcagaagcggtacttgcttctgcgaaagctggaattggtattgaagaa
attttagaacaaattgttgaaaaagtaccagctccggcaggtgattcagaagagccgtta
caatgtatgattttcgactctttatatgatccgtaccgtggtgtaattgcttatatccgt
gttgtaaatggaacggtaaaagttggcgataaagtacgtatgatggcaacgggtaaagaa
tttgaagtaacagaagtaggtgtatttacaccgaaaactacgcaacgtgacgagttaaca
gtaggtgatgtaggtttcttagcagcatctattaaaaacgtaggtgatacacgtgttggt
gatacgattacacatgcgaaacgtccagctgcagaggcgttaccaggttaccgtaaatta
aacccgatggtattctgtgggctgtatccaattgattctgctcgttataacgatttacgt
gatgcgttagaaaaattagagttaaacgattctgctcttgagtttgaaccagaaacatct
caagcgttaggatttggtttccgttgtggattcttaggacttcttcacatggaaatcatt
caagaacgtattgaacgtgaatttaagattgacttaattacaacagcgccaagcgttatt
tataaagtttatttaacaaacggtgaagatgttattgttgataatccatctaatatgcca
gatccacagtctatcgatcgtgtagaagagccgtttgtgaaggcttcaattatggttccg
aatgactatgttggagctgtaatggaaatttgccaaggtaaacgtggaacgtttattgat
atgcaatatttagatgaaacgcgtgttacattaacatatgaaatcccgttatcagaaatc
gtatatgacttcttcgatcaattgaaatcaaatacgaaagggtatgcatcatttgactac
gagttaattggttataaaccatctaaacttgtgaaaatggatattcttttaaataatgaa
caagtggatgctttatcatttatcgtacaccgtgattcagcgtatgaccgtggtaaagta
attgtagagaaattaaaagaattaattccgagacaacagttcgaagtaccaattcaggcg
actatcggaaataaagttgtagcacgttctacaattaaggcgatgcgtaaaaacgtactt
gcaaaatgttacggcggtgacatttctcgtaagcgtaaacttcttgataagcaaaaagaa
ggtaaaaaacgtatgaagtctgttggttctgtagaagtgccacaagaggcattcatggct
gtactgaaaatggatgacaactaa

DBGET integrated database retrieval system