KEGG   Bacillus thuringiensis Bt407: BTB_c44620Help
Entry
BTB_c44620        CDS       T02277                                 

Definition
(GenBank) hypothetical protein
Organism
btg  Bacillus thuringiensis Bt407
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3679 DUF3040
Motif
Other DBs
NCBI-ProteinID: AFV20143
Position
complement(4324353..4324718)
Genome map
AA seq 121 aa AA seqDB search
MREKDDNSLSRFALLCICSVALCLLMMIAGVSLANHGLKSMKGYRQLSYEQIAHMTGTES
TGVESEILGSSFSASEKQQQLERLRSFNVVEGIGMAVASVAYEMTKFGTDIVVGKIKGIF
S
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
ttgagggagaaagatgataatagtttgagtcgttttgcgcttttgtgtatatgtagtgta
gctttatgtttacttatgatgatagcaggagtgtcacttgctaatcatggtttgaaaagt
atgaaaggttatcggcaattgtcgtatgaacaaatagctcatatgacagggacagagagt
acaggtgttgaatcagaaattttgggtagttcgttttcagcttcagaaaaacaacaacaa
ttagaacgtttaagaagttttaatgttgtagaaggaattgggatggcggtagcaagtgta
gcttatgaaatgacgaagttcggaacggatatagttgttgggaaaataaaggggattttt
agctaa

DBGET integrated database retrieval system