KEGG   Bacillus thuringiensis Bt407: BTB_c44680Help
Entry
BTB_c44680        CDS       T02277                                 

Gene name
comEB
Definition
(GenBank) ComE operon protein 2
  KO
K01493  dCMP deaminase [EC:3.5.4.12]
Organism
btg  Bacillus thuringiensis Bt407
Pathway
btg00240  Pyrimidine metabolism
btg01100  Metabolic pathways
Module
btg_M00429  Competence-related DNA transformation transporter
Brite
KEGG Orthology (KO) [BR:btg00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    BTB_c44680 (comEB)
Enzymes [BR:btg01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.12  dCMP deaminase
     BTB_c44680 (comEB)
Secretion system [BR:btg02044]
 Type II secretion system
  Competence-related DNA transformation transporter (DNA-T) core components [MD:M00429]
   BTB_c44680 (comEB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dCMP_cyt_deam_1 MafB19-deam Sec2p Exonuc_VII_S
Motif
Other DBs
NCBI-ProteinID: AFV20149
Position
complement(4330200..4330757)
Genome map
AA seq 185 aa AA seqDB search
MERISWDQYFMTQSHLLSLRSTCTRLAVGATIVRDKRIIAGGYNGSIKGGVHCIDDGCYV
IDNHCVRTIHAEMNALLQCAKFGAKTEEAEIYVTHFPCLQCCKAIIQSGITAVYYAQDYK
NHPYAIELFEQANVTVKHVPLEYDIAALEEQKRYTELKELFASLEKDNLSMEELQHVFTK
TKMML
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atggaacgaatttcatgggatcaatattttatgacgcaaagccatctactatcgttacgt
agtacatgtacaaggcttgcggtaggagcgacaatcgttcgcgataaacgaattattgct
ggtggatataatggttcgattaaaggtggcgtacattgtatagatgatggttgttacgta
atcgataatcattgtgttcggacaattcatgccgaaatgaatgctttattacaatgtgcc
aagtttggtgcgaaaacagaggaagcagaaatttacgttacgcatttcccttgtttacaa
tgttgtaaggcaattattcaaagtggtattacagcggtttattatgcgcaggattataaa
aatcatccatacgccatagagttatttgaacaagcgaatgtaacagtgaagcacgttccg
ctagaatatgatatcgctgcattagaggagcaaaaacgttatacggagttaaaagaatta
tttgcgtctttagaaaaagataatttatcaatggaagaattacagcatgtattcacgaaa
acaaaaatgatgctataa

DBGET integrated database retrieval system