KEGG   Bacillus thuringiensis Bt407: BTB_c44690Help
Entry
BTB_c44690        CDS       T02277                                 

Gene name
comEA
Definition
(GenBank) ComE operon protein 1
  KO
K02237  competence protein ComEA
Organism
btg  Bacillus thuringiensis Bt407
Module
btg_M00429  Competence-related DNA transformation transporter
Brite
Secretion system [BR:btg02044]
 Type II secretion system
  Competence-related DNA transformation transporter (DNA-T) core components [MD:M00429]
   BTB_c44690 (comEA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HHH_3 SLBB HHH HHH_6 HHH_5 HHH_2 DUF3742 RNA_pol_A_CTD DUF177 T2SSK Ribosomal_S28e
Motif
Other DBs
NCBI-ProteinID: AFV20150
Position
complement(4330821..4331420)
Genome map
AA seq 199 aa AA seqDB search
MMWDFPKKWLGLVAIIGTLLFLVFWKTNQSVERTPITMNVQEKEIEKKGKPKISDTKEQK
RTIIIDVKGAVNKEGVYEMKEGDRVKDAVQKAGGFLSEVDMKKVNLAQIVQDQMLLYIPS
KNESEQGMFTSSKEDGKIRINTAAKEQLEKITGIGSRKAESILKYREEHGPFQKIEDLLE
IDGIGAKSLEKIKDQIIIP
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgatgtgggattttccgaaaaagtggttaggtttagtagctattattggaactttactt
tttcttgttttttggaaaacgaatcagagtgtagaacgaacgcctattacaatgaatgtg
caagagaaggagatagaaaaaaagggtaaaccgaaaatatcggatacaaaggaacagaaa
agaacaattataattgatgtgaaaggagcggttaataaagaaggggtatatgaaatgaag
gaaggagatcgcgtaaaggatgcggttcaaaaggctggtggttttttatcagaagtagat
atgaaaaaagtgaatttagcacaaattgtacaagatcaaatgcttctttatataccgagt
aaaaatgagtcagaacaagggatgtttacttcttctaaggaagatggcaagattcgaata
aatacagcagcgaaagagcaattggaaaaaattacagggattggctctcgaaaggcagaa
agtattttgaaatatcgagaagagcatggtccgtttcagaaaatagaagatttattagag
attgatgggattggtgcgaagtctcttgaaaagataaaagatcaaattattattccgtaa

DBGET integrated database retrieval system