KEGG   Bacillus thuringiensis Bt407: BTB_c44710Help
Entry
BTB_c44710        CDS       T02277                                 

Definition
(GenBank) putative methyltransferase
Organism
btg  Bacillus thuringiensis Bt407
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_25 Methyltransf_11 Methyltransf_31 Methyltransf_23 Ubie_methyltran Methyltransf_12 NodS CMAS MTS TehB Methyltransf_9 tRNA_U5-meth_tr Bin3 DUF559 Methyltransf_32
Motif
Other DBs
NCBI-ProteinID: AFV20152
Position
complement(4332506..4333255)
Genome map
AA seq 249 aa AA seqDB search
MKYEQFALLYDELMNDVPYDKWVEFTEESLQQADMKEAKILDVACGTGNVTLPLVQKGYD
LIGVDLSEEMLTVAQQKLGGEGYFIPFYQQDMRELDVPGEFDCVTIFCDSLNYVLQEDGV
QETFRRVFHHLRQDGLFLFDVHSLYKIHHVFQNETYTVNGEEISLIWNCFPGEESNSVEH
DLTFFVQDPEEDVYHRFDECHVQRAYQVEELTKWLEEAGFTVLRVTGDFERLEVTEQTER
IFFMAKKNG
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgaaatacgaacaatttgcattgttgtacgacgaactgatgaatgatgtcccttatgat
aaatgggtagaattcacagaggaaagcctgcagcaggcagatatgaaagaggcaaaaatt
cttgatgtagcatgcggtacgggtaatgtaacccttccgcttgtgcaaaagggttacgat
ttaataggtgtcgatctttcagaagaaatgttaacagtcgctcagcaaaaactaggagga
gagggatactttattcctttttaccaacaagacatgcgagagcttgatgttccaggtgag
tttgactgcgtcactatcttttgtgattcattaaattatgtattgcaagaagatggagta
caagaaacatttagaagagtgtttcaccatttgcgtcaagatggtttgtttttatttgat
gtacattctttatataaaatacatcatgtatttcaaaatgaaacgtatacagtgaatgga
gaagaaatatctcttatttggaattgcttccctggtgaagaatcaaatagtgtagagcat
gatttgacattctttgttcaagatccggaagaagatgtgtaccatcggtttgacgaatgt
cacgtgcaacgtgcatatcaagtggaagagttaacgaaatggcttgaagaagcaggtttt
acagttcttcgtgtaacaggtgattttgagcgacttgaagttacagaacaaacagaacgt
attttcttcatggcgaagaaaaacggataa

DBGET integrated database retrieval system