KEGG   Bacillus thuringiensis Bt407: BTB_c44760Help
Entry
BTB_c44760        CDS       T02277                                 

Gene name
aroE
Definition
(GenBank) shikimate dehydrogenase AroE
  KO
K00014  shikimate dehydrogenase [EC:1.1.1.25]
Organism
btg  Bacillus thuringiensis Bt407
Pathway
btg00400  Phenylalanine, tyrosine and tryptophan biosynthesis
btg01100  Metabolic pathways
btg01110  Biosynthesis of secondary metabolites
btg01130  Biosynthesis of antibiotics
btg01230  Biosynthesis of amino acids
Module
btg_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:btg00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BTB_c44760 (aroE)
Enzymes [BR:btg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.25  shikimate dehydrogenase
     BTB_c44760 (aroE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Shikimate_dh_N Shikimate_DH Methyltransf_25 ThiF TehB Staph_opine_DH
Motif
Other DBs
NCBI-ProteinID: AFV20157
Position
complement(4335171..4336004)
Genome map
AA seq 277 aa AA seqDB search
MKQLYGVIGNPIGHSLSPVMHNDAFEHLNMDAHYHAFLVEEEALGEAVRGLKALGISGFN
VTTPHKVAIMEYLDEIDPLARKIGAVNTVVHKNGRLIGYNTDGIGFVRALQSISNEPLQG
KRILLLGAGGASRAIYFSLADVGVKEIDVANRTVDKAKELIAARTADVNSVALSLEKATE
EQGNYDIIIQTTTIGMHPHVEHTPLQMCSLKKGTIVSDIIYNPFETKILCEAKEQGAIIQ
NGIDMFVYQGALAFEMWTGRVPNIDRMKQLVIEKLGG
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaattatatggtgtaatcggaaatccaattggacattcattatcacccgttatg
cataacgatgcatttgaacacttgaatatggatgcccattatcatgcattccttgttgaa
gaggaagcgctaggggaagcagtaagaggtttaaaagcattaggtatttcaggatttaat
gtaacaactccgcacaaggttgctatcatggagtatttggatgagattgatccattggca
aggaaaatcggtgcagtaaatacagtggttcataagaatggaaggttaattggctacaac
acagatggaattggttttgttcgagcgctgcagtcaattagtaatgaaccacttcaaggg
aaacgtattttgttacttggtgcaggtggtgctagccgagctatttatttttctcttgct
gatgtaggtgtaaaagagattgatgtagccaatcgtacagtagataaggcgaaagaactt
attgctgcacgtacggccgatgttaattctgttgctttgtcgttagaaaaagcgacagaa
gaacaaggaaattatgatattatcattcagacgacaacgataggtatgcatccacacgtc
gaacatacgccattacaaatgtgttcgttaaaaaaaggaacgattgtatcagatataatt
tataatccatttgaaacgaaaattttatgtgaggcaaaagagcaaggtgcaatcattcaa
aatggtattgatatgtttgtttatcaaggagcacttgcatttgaaatgtggacaggacgt
gtaccaaatattgatcgaatgaaacaattagttatagaaaagcttggaggctaa

DBGET integrated database retrieval system