KEGG   Bacillus thuringiensis Bt407: BTB_c44850Help
Entry
BTB_c44850        CDS       T02277                                 

Gene name
mhqN
Definition
(GenBank) putative NAD(P)H nitroreductase MhqN
  KO
K15976  putative NAD(P)H nitroreductase [EC:1.-.-.-]
Organism
btg  Bacillus thuringiensis Bt407
Brite
KEGG Orthology (KO) [BR:btg00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BTB_c44850 (mhqN)
Enzymes [BR:btg01000]
 1. Oxidoreductases
  1.-  
   1.-.-  
    1.-.-.-  
     BTB_c44850 (mhqN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Nitroreductase TM1586_NiRdase Ribophorin_II
Motif
Other DBs
NCBI-ProteinID: AFV20166
Position
complement(4343017..4343640)
Genome map
AA seq 207 aa AA seqDB search
MNFEELAIARRSAMKFIQGIEIPDEDFKKIFELTKLSPSCYNLQHTHYVVIRDQERKERL
KELAFGQYKVSSASAVVLVCGDKRAYQNVENIYFGMKVLKMIDECEYEDTIRQTKGLYEG
KGERFMEDEAIRNASLSAMTFMYAAKYYGYDTCPMIGFDEKAVQSELNMPEHVIPVLMIT
IGKSDTTKVRPRGYRKPISEFVTYESF
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
gtgaactttgaagaattagcaattgctagacgttctgcaatgaaatttatacaaggtata
gaaatccctgatgaggattttaaaaaaatatttgagttaactaagctttctccatcttgc
tataatttgcagcacacacattatgttgtaattcgtgatcaagagcgaaaagaaagatta
aaagaattagcgttcggtcaatataaagtatcgagtgcatcagcggtagtgctcgtttgt
ggtgataaaagagcataccaaaatgttgaaaatatttacttcggtatgaaagttttaaaa
atgattgatgaatgcgaatatgaagataccattaggcaaacgaaaggtttatatgaagga
aaaggagagcgtttcatggaggatgaagcgattagaaatgcttcgttaagtgcgatgact
tttatgtacgcagctaaatattatggctatgatacatgtccaatgattggtttcgatgaa
aaagcagtacaaagtgaattaaatatgccagagcatgtaatacctgttttaatgattacg
atagggaaaagtgatacgactaaagttcgtccaagaggatatcgaaagccaattagtgag
tttgttacatacgaatcgttttaa

DBGET integrated database retrieval system