KEGG   Bacillus thuringiensis Bt407: BTB_c44870Help
Entry
BTB_c44870        CDS       T02277                                 

Definition
(GenBank) hypothetical protein
Organism
btg  Bacillus thuringiensis Bt407
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LPAM_1 PCYCGC EPL1 Imm-NTF2 zf-met2
Motif
Other DBs
NCBI-ProteinID: AFV20168
Position
complement(4344723..4345190)
Genome map
AA seq 155 aa AA seqDB search
MEKIFRKLRFLLVFVVLLVGCQQEENNVEQKSTTKKTEEKVQITKEEEKSIQDVITTFVR
TTNEKNFAEHMELFSKKMPSAEDLKTQKEAAFQKGNKKIELEHIDMKASKVGYVIVETKE
KEVDDSVTLQKKVQYALGKEDEKWKIEEVRTIEKK
NT seq 468 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaaatatttaggaaattaagattccttctagtatttgtagtattactagttgga
tgtcaacaagaagagaataacgtagaacaaaaatctactactaaaaaaactgaggaaaag
gtacaaataacaaaagaagaagagaaatctattcaagatgttattactacatttgtgcga
acgacgaatgaaaaaaattttgcagaacatatggagttattttcaaagaagatgcctagt
gctgaagacttaaaaacacaaaaagaagccgcatttcaaaagggaaataagaagattgaa
ttggaacatatagatatgaaagctagtaaagtagggtatgttattgttgaaacgaaagaa
aaggaagtagacgatagtgtcactcttcaaaagaaagtacagtacgctcttggaaaagaa
gatgagaaatggaagattgaagaggttcgcacgatagagaaaaaataa

DBGET integrated database retrieval system