KEGG   Bacillus thuringiensis Bt407: BTB_c44880Help
Entry
BTB_c44880        CDS       T02277                                 

Gene name
phoB
Definition
(GenBank) alkaline phosphatase 3
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
btg  Bacillus thuringiensis Bt407
Pathway
btg00730  Thiamine metabolism
btg00790  Folate biosynthesis
btg01100  Metabolic pathways
btg02020  Two-component system
Module
btg_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:btg00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    BTB_c44880 (phoB)
   00790 Folate biosynthesis
    BTB_c44880 (phoB)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BTB_c44880 (phoB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:btg04147]
    BTB_c44880 (phoB)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:btg00537]
    BTB_c44880 (phoB)
Enzymes [BR:btg01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     BTB_c44880 (phoB)
Exosome [BR:btg04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BTB_c44880 (phoB)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:btg00537]
 Enzymes
  BTB_c44880 (phoB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme Sulfatase Tubulin
Motif
Other DBs
NCBI-ProteinID: AFV20169
Position
complement(4345245..4346630)
Genome map
AA seq 461 aa AA seqDB search
MKKFVKKAWPFAVVASLAVTSVATWNFTRSSEVNADENGSNAKIKNVIVLIGDGMGPSYM
TAHRYMKDNPKTFEMESTEFDKHLVGTQKTYPEDEHENITDSASAATAMSAGIKTYNAAI
AVDNDKAEVKTVLEQAKEKGKSTGLVATSEITHATPAAFGAHDISRKNMDAIANDYFDEK
IKGKHKVDVMLGGGVKNFVRKDRNLTEEFKKSGYSYVTDRDQLLNDKNDQILGLFAPGGL
DKMIDRNDKTPSLEEMTNAAIERLNKNKNGFFLMVEGSQIDWAGHDNDIVGAMSEMEDFE
KAFKAAIEFAKKDKNTLVVATADHATGGLSLGANGEYNFKVDPIKAAKRTPDFMANEIAK
GANVEETLKKYIDLQLTPEEIQAVNDIAPSKDVTKIDNAIEDIFNKRSVTGWTTGGHTGE
DVNVYAFGPGKYLFSGVQENTNIAKRVFDIVGGGDPNKGRR
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaagtttgtgaaaaaagcatggccatttgcagttgtggcatcattagcagttact
tcggtagcaacatggaattttactcgttctagtgaggttaatgcagatgagaacggaagc
aatgcaaagattaaaaatgttatcgtattaattggggatggtatgggcccttcatatatg
acggctcaccgttatatgaaagataatccaaaaacctttgaaatggaatctacagaattt
gataagcatcttgtaggaacacaaaaaacatacccagaagatgagcatgaaaatattaca
gactctgcatcagcagcaacagctatgtcagcagggattaaaacatataatgctgcaatt
gcagttgataatgataaagcggaagtgaaaacggttcttgagcaagcgaaagaaaaaggg
aaatcaacgggacttgttgcaacttctgaaattacacatgcaacaccagctgctttcggt
gcgcatgacattagccgtaaaaatatggacgcaattgcaaatgattattttgatgagaaa
attaaagggaagcataaagtagatgttatgcttggcggcggtgtaaagaactttgttaga
aaagatcgtaatcttacagaagagtttaagaaatctggttatagctatgtaacggatcga
gatcaattgttaaatgataaaaatgatcaaattcttggtttatttgcaccaggtggatta
gataaaatgattgatcgtaatgataaaacaccttcattagaagaaatgactaatgcagca
attgagcgtttgaacaaaaataaaaatggtttcttcttaatggtggaaggaagtcaaatc
gactgggctggacatgataatgatatcgttggtgcaatgagtgaaatggaagacttcgaa
aaagctttcaaagcagcgattgagtttgcgaaaaaagataaaaatacgttagttgttgca
acggcagaccacgctacaggtggattatctttaggtgccaatggcgagtataactttaaa
gtagatccaattaaagctgcaaaacgcacaccagactttatggcaaatgagattgcaaaa
ggtgcaaatgtagaagaaacattgaaaaagtatattgatttacaattaactccagaagaa
attcaagctgtaaatgatatagctccgtcaaaagatgtaacaaagattgataatgcaatt
gaagatattttcaataagcgctcggttacaggctggacaactggtgggcatacaggggaa
gatgtgaacgtgtatgcatttggtccaggtaaatacttattctcaggcgttcaagagaat
acaaatatagcgaaacgtgtctttgatatcgttggcggtggcgatccgaataaaggaaga
cgttaa

DBGET integrated database retrieval system