KEGG   Bacillus thuringiensis Bt407: BTB_c44900Help
Entry
BTB_c44900        CDS       T02277                                 

Definition
(GenBank) lipase
Organism
btg  Bacillus thuringiensis Bt407
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_1 Hydrolase_4 Abhydrolase_6 Thioesterase DUF1057 Abhydrolase_5 PGAP1 BAAT_C FSH1 Peptidase_S9 Esterase Ndr
Motif
Other DBs
NCBI-ProteinID: AFV20171
Position
4347742..4348626
Genome map
AA seq 294 aa AA seqDB search
MKRFSYFMVGCLTLTLLVGCSAAEKPVEQVKQVKNTITAKLATEEKMVEIDGQTIYFKKI
GNEKPPLLMIHGFGGSSDGFQKIYSDLAKDHTIISVDALGFGRSSKPMDFYYSFPTHANL
YYKLMKKLGYDSFAILGHSMGGEISLNLTYLYPEAVTHLILTDATGGPHTFVTKQGSPKP
QLSTDLNAVSSITDYDESKVKFKRNDEEHYNKMKLWPRRLKINANEMKQPTLIIWGRNDS
SVSWKEGETYHQFLKNSTLHIIEKGYHAPFRQEPQEFVGYVQDFFKNNPIKVEK
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
ttgaagcgatttagctattttatggtaggttgtcttactcttacactattagtaggatgt
agtgcagcagaaaagccagtagaacaagtaaagcaagtgaaaaatacaattacagctaaa
ctagctaccgaggaaaaaatggtagaaatagatggtcaaaccatttactttaaaaagatt
ggtaatgaaaaaccacctttacttatgattcatggctttggagggtcatcagatggtttt
caaaagatttactccgatttagcaaaagatcatacaattatttctgtagatgctttagga
ttcgggcgctcatctaagccaatggatttttattattcttttccaactcatgcaaatttg
tattataaattaatgaaaaaactagggtatgattcattcgcaatactggggcattccatg
gggggagaaatttctctaaatttaacatatttatatcctgaagcagttactcaccttatt
ttaactgatgctacaggtggtcctcatacattcgttactaaacaaggctcaccaaaacca
caattgtcgactgatttaaatgccgtttcttctattactgattatgatgagagcaaagtg
aaattcaaacgtaacgatgaagagcattataacaaaatgaaactatggcctagacgtctt
aaaattaatgcgaatgaaatgaaacagcctactttaattatatggggcagaaatgatagt
agcgtttcttggaaagaaggagaaacgtatcatcaattcttaaaaaatagcactttacat
attattgaaaaaggttatcatgcaccatttcgccaagaaccacaagaatttgtcgggtat
gtacaagacttctttaagaacaatccgatcaaagttgaaaaataa

DBGET integrated database retrieval system