KEGG   Bacillus thuringiensis Bt407: BTB_c44920Help
Entry
BTB_c44920        CDS       T02277                                 

Definition
(GenBank) hypothetical protein
Organism
btg  Bacillus thuringiensis Bt407
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AFV20173
Position
complement(4349567..4349968)
Genome map
AA seq 133 aa AA seqDB search
MLNIALVVGFNSDLEAQSIRASLEYFGARVVIYWIGRPKDFVEVLSGKNLFNDINYIIFC
FHGEEGKFVMEELDEEVYEQDEPRGYFGTAEIYKYAKLHNTHIVNSGCTLGEKNIAKSFY
IVVQNHILDRLIM
NT seq 402 nt NT seq  +upstreamnt  +downstreamnt
atgttgaatattgcattagtagttggttttaattcggatttagaggcgcaatcaatccga
gcatctcttgagtattttggtgcaagagttgtgatatattggattggtagaccgaaagat
tttgtggaagttctttctggaaagaacttatttaacgatattaattatattattttttgc
tttcatggtgaagaaggaaagtttgtcatggaagaattagacgaagaagtatatgaacaa
gatgaaccgagaggatattttggtacagcagaaatttataaatatgcaaaattgcataat
acacatattgtaaatagcgggtgcacgttaggggagaaaaatattgcaaaatctttttac
atagtggtgcaaaatcatatattggatcgattgattatgtag

DBGET integrated database retrieval system