KEGG   Bacillus thuringiensis Bt407: BTB_c44940Help
Entry
BTB_c44940        CDS       T02277                                 

Definition
(GenBank) hypothetical protein
Organism
btg  Bacillus thuringiensis Bt407
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2178 TRIQK
Motif
Other DBs
NCBI-ProteinID: AFV20175
Position
4350744..4351082
Genome map
AA seq 112 aa AA seqDB search
MKWIIVFIGMIVWGYINGFFSSDKTANPWITDDERETKIKQKAITASWSGVFMFCTISLL
NKWLGLSTNDNSPYLPDPIAAILKANVELQVLLMLFVMYGIFYLHYRRKLSA
NT seq 339 nt NT seq  +upstreamnt  +downstreamnt
atgaaatggataattgtctttattggaatgattgtatggggatatataaacggcttcttt
agtagtgataaaactgctaatccttggattacagatgatgaacgtgaaacaaaaattaaa
caaaaagcaattacggcaagctggtccggtgtttttatgttttgtaccattagcctctta
aataaatggttaggtttaagcacaaatgataactcaccgtacttaccagaccctatcgca
gctattttaaaggcaaatgtagagttacaagttttactcatgctatttgttatgtatgga
atattttacttacattatcgaagaaaattaagtgcctaa

DBGET integrated database retrieval system