KEGG   Bacillus thuringiensis Bt407: BTB_c44950Help
Entry
BTB_c44950        CDS       T02277                                 

Definition
(GenBank) hypothetical protein
Organism
btg  Bacillus thuringiensis Bt407
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF4023 BRF1
Motif
Other DBs
NCBI-ProteinID: AFV20176
Position
4351152..4351274
Genome map
AA seq 40 aa AA seqDB search
MSNSNEFLDTLHEKQAKDEQNRKRQGNGNPAKKKPNKTHK
NT seq 123 nt NT seq  +upstreamnt  +downstreamnt
atgagtaactcgaatgaatttttagatacactacatgaaaaacaagcaaaagatgaacaa
aatagaaagcgccaagggaacggaaacccagcgaaaaaaaagccaaataaaacacataaa
taa

DBGET integrated database retrieval system